KEGG   Lactobacillus acidophilus 30SC: LAC30SC_08025Help
Entry
LAC30SC_08025     CDS       T01436                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LAC30SC_08025
  Lipid metabolism
   00561 Glycerolipid metabolism
    LAC30SC_08025
   00600 Sphingolipid metabolism
    LAC30SC_08025
Enzymes [BR:lai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LAC30SC_08025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546184..1548385)
Genome map
AA seq 733 aa AA seqDB search
MKQELITFDEKNKVFHLHNDQISYLLSVEDGGTLCHLYFGKKVNNYHNQLRYPRLDRGFS
GNLPGSLDRTFSRDSLPKEYSTAGEMDYHTPAAVVRQADGSNALFLTYKDYRIEDGKPNL
KGLPHSWVKDKSEAQTLIITLEDKKTELNFDLLYTIYRDRPVIVRSVKVKNAGKETVNLE
KVASMQIDFVDRNFESITLPGAHAHERRVDRSKIHQGIHVFSSHRGTSSHQMNPFLALVD
PDTNEFQGDAYGFAFVYSGNHKFEVEKDQFAQTHVNVGINDFNFNWQLNAGDAFQTPEVL
MVYSDQGLNKMSQAFHSLIHDRIIRSKYKNEVRPIVVNNWEATYFDFNEDKLKTIVDDAK
KLGIEMFVLDDGWFGHRNDDNSSLGDWKVFAKKFPRGLDHFADYVHEQGLKFGLWFEPEM
ISYDSDLYKNHPDYLMHVPGRNPSPSRNQYLLDLGRKEVRDNIFDQMEKILGSGKIDYIK
WDMNRHLSDIYEADLPANRQGEVYHRYVLGLYDLLERIVDAHPDLLIEGCSGGGGRFDAG
MAYYDPQIWASDDSDAIDRLTIQYGTSLVYPQSMMTSHVSVSPNEQNGRITPFNTRGIVA
MWGDLGYELDLTKLSQEDRKAVAKQVAAYKKIRKVTQFGKFYRLKSAQTSNQCAWETVSA
DQNEVVLSTVKVMASAQPYLTKTKLVGLDPNKQYEDQATHEVYGGDELMNMGFYDPAEHG
DFKAYMCHFKAID
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaattaatcacttttgatgaaaaaaacaaagtttttcatctacacaatgat
caaatttcatatcttctttcagtagaagatggtggtacgctttgccatttgtattttggc
aaaaaagtgaataattaccataatcaattacgctatccacgtcttgatcgcggcttctct
ggtaatttgccaggatcacttgatagaactttttcaagagattctttgcctaaagaatat
agtacagctggtgaaatggattatcacactccagctgctgtagtacggcaagctgatggt
tctaatgctttgtttttaacttataaggattatcgtattgaagatggtaagccgaattta
aagggattacctcattcatgggtaaaagataaaagtgaagctcaaactctaattattact
cttgaagataagaaaaccgagttgaactttgatttgctctacactatttatcgtgatcgt
ccagttattgttcgctcagtaaaagtgaagaatgcaggaaaggaaacggtcaatcttgaa
aaagttgcttctatgcaaatcgattttgtagatcgtaattttgaatcaattactttgcct
ggtgcacatgcgcatgaacgaagagtggatcgtagtaagattcatcaaggtatccatgtc
ttttcaagtcatcgtggtacttcaagtcatcaaatgaatccattcttggctctagttgat
cctgatacaaatgaattccaaggggatgcatatggttttgcctttgtatattctggcaac
cataagtttgaagtcgaaaaagatcaatttgcgcaaactcatgtaaacgttggaattaac
gactttaactttaattggcagttgaatgcaggggatgcatttcaaacccctgaagtctta
atggtttactcagatcagggtttaaataaaatgagtcaagcctttcacagcttgattcat
gatcgaattattcgtagcaagtataagaatgaagttcgtccaattgtagtgaacaactgg
gaagcaacttactttgatttcaatgaagataaattaaagaccattgttgatgatgccaag
aaattaggtattgagatgttcgttcttgatgatggttggttcggtcaccgtaatgatgac
aattcttcattaggtgactggaaagtatttgcaaaaaagttccctagaggattagatcat
tttgctgattatgttcatgagcaaggcttgaaatttggtttgtggtttgaacctgaaatg
atttcatatgattctgatctttacaagaatcatcctgattatttgatgcatgttcctggt
agaaatcctagtccatcaagaaatcagtacttgcttgatttaggtcgtaaagaagtacgt
gacaatatttttgatcagatggaaaagattttaggatcaggcaagattgattacatcaaa
tgggatatgaatcgtcacttgtctgatatctatgaagcagatttaccagcaaatcgacaa
ggagaagtttaccatcgctatgttctaggtctttatgacttattagaaagaattgttgat
gcccatccagacctcttaattgaaggctgttctggtggcggtggtcgttttgatgccggt
atggcttactatgatccacaaatttgggctagtgatgatagtgatgccattgatcgttta
accattcaatatggtacgagtttggtttatccgcaatcaatgatgacttcacacgtatca
gttagtcctaatgaacaaaacggtcgaattactccattcaatactcgtggcatagtagca
atgtggggcgatcttggttatgaacttgatttaaccaagttaagccaggaagaccgtaag
gcggtggctaagcaggttgctgcatacaaaaagattagaaaagtgacccagtttggcaag
ttctatcgtttgaagtcagcccaaactagcaatcagtgtgcttgggagactgtttcagcc
gatcaaaatgaagtcgtattaagcacagttaaagtaatggcttcagctcaaccatattta
actaagacgaaattagttggtcttgatccaaataaacaatacgaggatcaagctactcac
gaagtttatggtggcgatgaactgatgaatatgggcttttatgatcctgctgaacatggt
gattttaaagcctatatgtgtcactttaaagcaatagactag

DBGET integrated database retrieval system