KEGG   Lactobacillus acidophilus 30SC: LAC30SC_08430Help
Entry
LAC30SC_08430     CDS       T01436                                 

Definition
phosphoribosyl glycinamide formyltransferase
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lai00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lai00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1632482..1633078)
Genome map
AA seq 198 aa AA seqDB search
MRVAILASGNGTNFEALTKQFQAGEIPGTEALMFCNHPNAPVIKRAERLGVPYETFSVKE
CGGKDAYEKRLLKVLQDYQIDFIVLSGYLRVVGPTILNEYPNSIINLHPALLPKYPGLNS
IERAFDDYKKGKIKETGVTVHFIDAHLDHGPIIAQQAVPIYPDDTVDTLEARVHETEHKL
FPATLRKVLSQRMEKEEN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgctattttagcttctgggaatggaaccaactttgaagctttaactaaacag
tttcaagctggcgagattcccggaaccgaggctttaatgttttgcaatcatccgaatgct
ccggtaattaagagagctgaaagattaggcgtgccatacgaaactttttccgttaaagaa
tgcggtggcaaagatgcctatgaaaagcgtctgctaaaagttttgcaagattatcaaatt
gatttcattgttttgtcagggtatctcagagtggttggtcccacgattttaaacgaatat
ccaaattcaatcatcaacttgcatccggcactattgcctaaatatccgggccttaattca
atcgaaagagcttttgatgattataaaaaaggcaagataaaagaaactggcgtcacagtc
cactttattgatgcccatttagatcacggaccaatcattgctcaacaggcagtaccaatt
tatccagatgatacggttgatacgctcgaagcaagggtccatgagacagaacacaaatta
ttcccagctacgttaagaaaagtattaagtcaaagaatggaaaaggaagaaaactaa

DBGET integrated database retrieval system