KEGG   Lactobacillus acidophilus 30SC: LAC30SC_10210Help
Entry
LAC30SC_10210     CDS       T01436                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LAC30SC_10210
Enzymes [BR:lai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LAC30SC_10210
Exosome [BR:lai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAC30SC_10210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1973260..1974762)
Genome map
AA seq 500 aa AA seqDB search
MKEKYILSIDEGTTSTRAIIFDHDGKEIASAQKEIKQYFPEPGWVEHDANEIWMAVQTTI
ANAFIQSGIWPGQIAAIGITNQRETTVVWDKETGEPIYRAVVWQSRQTTELAEKLKKESY
GEKIREKTGLIIDPYFSATKIRWILDHVPGAQEKAEQGKLLFGTIDSWLVWKLTDGQKHV
TDYTNASRTMLFNIHTLKWDKDILKLLNIPEQMLPEVRSNSEVYGKTATYMFFGGEVPIA
GMAGDQQAALFGQLALKPGMVKNTYGTGAFIVMNTGDKPTTSNNNLLTTIGYGINGKITY
ALEGSIFVAGSAIQWLRDSMKLIKNAPDSEKAAYESTSKNEVYVVPAFTGLGAPYWDAEA
RGAIFGVTRGTTDKDMIKATLQSLAYQTRDVVDTMQKDSGIDIPSLRVDGGASNNNYLMQ
FQADILGKKIERTKVLETTSMGAAFLAGLAVGYWKNIDELKHVFTIGQAFEPKMGELERE
KLYSGWQRAIKATRVFAHGK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaatatattttatctattgatgaaggaacgacttcaactagggcaattatt
tttgatcatgatggaaaagaaattgcctcagctcaaaaagaaattaaacaatactttcct
gaaccaggctgggtagaacacgatgccaatgaaatttggatggcagtgcagactacaatt
gccaatgcttttattcaatcaggtatttggccaggacaaattgccgctatcggaattacg
aaccaacgtgaaactactgtagtttgggataaagaaaccggtgaaccaatttatcgcgca
gttgtgtggcaatcacgtcaaacaactgaattagccgaaaagctgaagaaagaaagttat
ggtgaaaagatcagagaaaagactggtttaattatcgacccatatttcagcgcaactaag
attcgctggattcttgatcatgtgccaggtgcgcaagaaaaggcggagcagggcaagctt
ttatttggaacaatcgatagctggttggtctggaaattgactgatggacaaaaacatgtg
actgactacaccaatgcttcaagaaccatgctctttaacattcatacccttaagtgggat
aaagatattttgaagctgctcaatattccagagcaaatgttaccagaggtgcgttctaac
tctgaagtttatggcaagacggctacttacatgttctttggtggagaagtgccaattgcc
ggaatggcaggggaccaacaagctgctttgtttggtcagcttgctttaaaacctggcatg
gtgaaaaacacttatggaacaggtgcctttatcgtgatgaacactggcgataaaccaacc
acgtctaacaataatttactgacgacgattggttatggcatcaacggcaagattacttac
gccttagaaggttcaatctttgtggcaggtagtgcaattcagtggctgcgtgattcgatg
aaactaattaagaatgctcctgattctgaaaaggcagcatatgagtcaacttccaaaaat
gaagtctatgtcgtgcctgcatttacgggacttggcgcaccatattgggatgcggaagca
cgtggtgcaattttcggtgttacacgtggaactactgacaaagatatgattaaagcaacg
ttgcaatcactggcctatcaaactagggatgtagttgatacgatgcaaaaagattccggt
atcgatattccatcccttcgcgttgacggtggtgcaagtaacaataactatttgatgcaa
ttccaagcagatattttgggtaaaaagattgaacgaaccaaggtgctcgaaacaaccagt
atgggtgccgcatttttagccggtcttgcagttggctattggaaaaatattgatgaattg
aagcatgtcttcactattggtcaggcatttgagcctaagatgggtgaactagagcgagaa
aaattgtattcaggttggcaacgtgcaattaaagctacacgagtttttgcacacggtaaa
taa

DBGET integrated database retrieval system