KEGG   Lingula anatina: 106162382Help
Entry
106162382         CDS       T04921                                 

Definition
(RefSeq) monoglyceride lipase-like isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
lak  Lingula anatina
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lak00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    106162382
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106162382
Peptidases [BR:lak01002]
 Serine Peptidases
  Family S33
   106162382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 303 aa AA seqDB search
MTQASEKQTPQGVPYSTVPHFVSNVGHTIFCKYWDTKFKEDSRKPRALLFIAHGLNEHCL
WYDILAEPLADKDVLTFSHDSYGHGQSEGTRVDLEDWSIYIKDIFQHCDEMKEKYPDIPL
FLLGHSLGGAMAITATLERPDYFRGMILIAPSVVPHPDNVTPFKVFLAKILARWTPQLQL
GKLPHDNMCRNKDVVEKYNADPLVWQGGMKARFGVSALKGLKAIEANLHAVTTPFLVLHG
TGDRITDHKGSEMLHEKAQSTDKTIKLYDGYYHQLHYEPDDDGAEVRQDIFDWILARIDA
PSG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggccagtgaaaaacaaactcctcaaggtgtcccctacagcaccgtgcctcat
ttcgtcagcaacgttggccacacaatcttttgcaagtattgggatacgaagttcaaagag
gacagccggaaaccgagagccctgttgttcattgctcatggtttaaatgagcactgtttg
tggtacgacatcctagcagagcctctggcggacaaagatgtattgaccttctcccatgat
agctatggccacgggcagagtgaaggaacacgagttgacttagaagattggtccatttac
attaaagatatctttcaacactgtgatgaaatgaaggaaaagtatccagacattccactg
ttcttactgggacattcactgggaggggcaatggctatcacggccactctagaaagacct
gattatttccgtgggatgatcctgatagcacccagtgtagtgcctcatccagacaatgtc
actccttttaaagtgtttttagctaagattcttgccagatggacaccccaacttcagttg
gggaaattaccacatgataacatgtgcaggaacaaagacgtggtagagaagtataatgca
gatccactggtttggcagggaggaatgaaggcaaggtttggcgtgagtgccttgaaaggg
ttaaaagccattgaggccaacttgcacgcggtcaccacaccatttctggtccttcatgga
actggggacaggataactgaccacaaggggtcagaaatgctccacgagaaggctcaaagt
acagacaagacaatcaagctttatgatggttactaccaccagcttcactatgaacccgat
gatgatggtgctgaagtgagacaggacatctttgattggattctggcaagaattgatgca
ccctctggctag

DBGET integrated database retrieval system