KEGG   Lingula anatina: 106167191Help
Entry
106167191         CDS       T04921                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lak  Lingula anatina
Brite
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106167191
Peptidases [BR:lak01002]
 Serine Peptidases
  Family S33
   106167191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 179 aa AA seqDB search
MGGAIVGNYAAMYPEDVATVTLLCPLMKTPIPSTMIADAKAGRTTALQDAFSPEAVQFML
DQCSVEKRQYPRVLLEGIAELRRRHEAFFSKLYFALGKHENRTALETSLPKIAVPVHVLW
GDQDQIVHVSGTEVIERVSPRSRITILKNKGHSLNLECPQIVVDSVLDSTRVTIPKSSL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggcggagctatagttgggaactacgccgccatgtacccggaagatgtcgccactgtc
accttactgtgtccattgatgaagacgccgattcccagcaccatgattgcggacgccaag
gctgggaggaccacggccttacaagacgccttcagtccagaggcggtccagtttatgctt
gaccagtgttccgtggaaaaacgtcaatatccacgcgtgctcttggaaggcatagcagag
ttgagaaggcggcatgaagcttttttcagcaaattgtattttgcgctggggaagcatgag
aaccggacagcactggagacctcacttcccaagatagcggtccccgttcacgtgctttgg
ggtgaccaagaccagatcgttcacgtctcagggacggaagtcatagaaagggtgtcgccc
aggagcaggataacgatattaaagaacaagggtcactctttaaacctggaatgtccgcag
attgtagtggacagcgttctggactctacacgtgtcacgataccaaagtcttccctataa

DBGET integrated database retrieval system