KEGG   Lactobacillus amylovorus GRL 1112: LA2_01065Help
Entry
LA2_01065         CDS       T01371                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LA2_01065 (gpmA)
   01230 Biosynthesis of amino acids
    LA2_01065 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA2_01065 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LA2_01065 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LA2_01065 (gpmA)
Enzymes [BR:lam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LA2_01065 (gpmA)
Exosome [BR:lam04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LA2_01065 (gpmA)
  Exosomal proteins of melanoma cells
   LA2_01065 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212509..213201
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESGQLWIPETKTWRLNERHYGALQGLNKKKTAEKYGDEQVHIWRRSYDVL
PPAIDDDNKYSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDENLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattt
actggttgggttgacgttaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaatcaaggaacacggtcttgaatttgaccaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtggccaactttggattccagaaact
aagacctggagacttaacgaacgtcactacggtgctcttcaaggtttgaacaagaagaag
actgctgaaaagtacggcgatgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgacaacaagtacagccaagctcacgaccgtcgttacgcaaac
ttggacccacacatcgtgcctaaggcagaaaacttacacgtatgtcttgaccgtgtaatg
ccattctgggaagatcacattgctccagacttacttgacggcaagaatgtaattatcgca
gctcacggtaactcacttcgtgctttgactaagtacatcgaaaacatttctgacgacgac
atcatgaacctcgaaatgaagactggtgaaccagttgtttacacattcgacgaaaacctt
gatgttgttaacaaggaaaagttggacgactaa

DBGET integrated database retrieval system