KEGG   Lactobacillus amylovorus GRL 1112: LA2_01795Help
Entry
LA2_01795         CDS       T01371                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lam00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
348544..350043
Genome map
AA seq 499 aa AA seqDB search
MAKEKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIEDTDQKRNVKGGSKSQ
MENLHWLGIDWDEGPDKGGDYGPYRQSERKEIYQKYIDQLIDEGKAYYSYKTEEELEAQR
EEQRAMGVAPHYTYEYEGMTADEIKQAQDEAKAKGLKPVVRIHIPEMETYSWDDIVKGHL
EFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMKITHVLRGDDHVSNTPKQLVVYEALGW
KPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLPEAMFNFITLLGWSPKGENE
IFTKREFIKQFDPARLSKSPAAFDQKKLEWINNQYIKKADRDTLLDLALNNLQEAGLIDE
HPTPEKMEWVRQLVNIYSVQMSYTKQIVDMAKIFFKDAKDLSDEEIEEIKNDDGRGVIEE
FKKQLDLIPRFTSVQIMNAIQATRKATGVKGRKLFMPIRIATTRSMVGPGIGEAMELLGK
KRVVEHIDLTLKQMSANNL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagaaaaaatccgtgtaagatatgcaccaagtccaactggtcacttgcacatt
ggtaacgcacgtactgcactttttaactatttattcgcccgtcacaacaagggtactatg
gtattgagaattgaagataccgaccaaaaacgtaacgttaagggcggttctaagtctcaa
atggaaaaccttcactggctaggcattgactgggatgaaggtcctgacaagggtggagac
tacggtccataccgtcaatcagaaagaaaagaaatttaccaaaagtatattgatcaattg
atcgacgaaggcaaggcatactactcatacaagactgaggaagaacttgaagctcaacgt
gaagaacaacgtgctatgggtgttgctcctcactacacttacgaatacgaaggtatgact
gctgacgaaattaagcaagctcaagacgaagctaaggcaaagggtcttaagccagttgta
cgtattcacattccagaaatggaaacctactcatgggatgatatcgttaagggtcacctt
gaattcgaatcagacactatcggtggtgacttcgttattcaaaagcgtgacggtatgcca
acttacaactttgccgttgtaattgacgaccacttgatgaagattacccacgtacttcgt
ggtgatgaccacgtttcaaacactcctaagcaattagtagtttatgaagcacttggctgg
aagccacctaagtttggtcacatgactttgatcattaactcagaaactggtaagaagctt
tctaaacgtgacgaatcagttcttcaatttattgagcaatatcgtgaccttggttattta
ccagaagctatgttcaacttcattacacttcttggttggtcaccaaagggtgaaaacgaa
attttcactaagcgtgaattcatcaagcaatttgatccagctcgtttgtctaaatcacct
gctgcctttgaccaaaagaagcttgaatggattaacaaccaatacatcaagaaggctgac
cgtgataccttgcttgaccttgctttgaacaacttgcaagaagcaggcttaattgatgaa
cacccaaccccagaaaagatggaatgggtacgtcaattggttaacatttactcagtacaa
atgtcatacactaagcaaatcgttgacatggctaagatcttctttaaagatgctaaggat
ctttcagacgaagaaattgaagaaattaagaacgatgatggtcgcggcgtaattgaagaa
ttcaagaagcaattagacctcattccaagatttacttcagttcaaatcatgaatgctatc
caagctactcgtaaggcaactggcgttaagggtagaaagctctttatgccaatcagaatt
gctactactcgttcaatggttggccctggtatcggtgaagccatggaacttttgggtaag
aaacgtgttgtagaacacattgacttaaccttgaagcaaatgagtgctaacaatctttaa

DBGET integrated database retrieval system