KEGG   Lactobacillus amylovorus GRL 1112: LA2_01970Help
Entry
LA2_01970         CDS       T01371                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LA2_01970 (recR)
DNA repair and recombination proteins [BR:lam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LA2_01970 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
376826..377425
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIAHLIDAYMKLPGIGEKTATRLAFYTMDMPQEDVEDFARALIQVKKDIHQCPIC
GNITEKDICDICSNPNRDQTTIMVVEQPKDVMSFEEMGEYSGLYHVLHGVLSPMDGIGPE
EINIKSLITRLQKHDEVKEVILALNSTPEGESTAMYISKLIKPAGIKVTRLAAGLSVGSD
IEYANSITLKRAVQGRTTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccattaccaatagctcatttaattgatgcttatatgaaacttccaggcatt
ggtgaaaagaccgccactagattggctttttacacaatggatatgccgcaagaagatgtg
gaagattttgctagagcattaattcaagtgaaaaaagatatccatcaatgtccaatttgt
ggcaatattaccgaaaaagatatctgtgatatttgttctaaccctaatcgtgatcaaaca
acgattatggtggttgaacagcctaaagatgtaatgtcttttgaagagatgggtgaatac
agcggtttgtatcatgtgcttcacggcgtattatcaccaatggatggaattggtccagaa
gaaatcaacattaaatctttaattactcgtttgcaaaagcatgacgaagttaaagaagtg
attttagctcttaattcgactcctgagggtgaatcaaccgcaatgtacatcagcaaattg
atcaaaccagctggtattaaagttactcgcttagctgcaggtttatctgtaggtagcgat
attgaatatgccaattcaattactttgaaacgggcagtacaaggaagaacgactctataa

DBGET integrated database retrieval system