KEGG   Lactobacillus amylovorus GRL 1112: LA2_02445Help
Entry
LA2_02445         CDS       T01371                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
lam00010  Glycolysis / Gluconeogenesis
lam00071  Fatty acid degradation
lam00350  Tyrosine metabolism
lam00620  Pyruvate metabolism
lam00625  Chloroalkane and chloroalkene degradation
lam00626  Naphthalene degradation
lam00650  Butanoate metabolism
lam01100  Metabolic pathways
lam01110  Biosynthesis of secondary metabolites
lam01120  Microbial metabolism in diverse environments
lam01130  Biosynthesis of antibiotics
lam01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA2_02445
   00620 Pyruvate metabolism
    LA2_02445
   00650 Butanoate metabolism
    LA2_02445
  Lipid metabolism
   00071 Fatty acid degradation
    LA2_02445
  Amino acid metabolism
   00350 Tyrosine metabolism
    LA2_02445
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LA2_02445
   00626 Naphthalene degradation
    LA2_02445
Enzymes [BR:lam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LA2_02445
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LA2_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADQ58473
UniProt: E4SLU5
Position
483017..485644
Genome map
AA seq 875 aa AA seqDB search
MAKTQQKQTLTEEEKKKQIYDMVDNLVKKSHVALDQMANFTQEQVDKICEAVATAGEQNA
YPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIEEDKELGLTKIAEPKGV
IAGVTPVTNPTSTVIFKAMLALKTRNTIIFGFHPQAQKCCVETGKIIRAAAVAAGAPADA
VQWIEEPSLDATTDLMNNPGVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKSAN
IDRAVYDIVLSKNFDNGMVCASENSVVVDDEIYDKVVDEFKKWDCYFLNKEEIKKFEEHF
IDPRRGTVAGPVAGKSAYEIAKLCGVDVPKNTKVIVAEYNGVGRKFPLSAEKLSPVFTLY
RAKNHDDAFRICSELLDYGGRGHTAGLHSSDKKIIDEFAMKMDACRILVNSPAALGGIGD
LYNNMLPSLTLGTGSYGANTFSHNIGAKDLLNIKTVAMRRDNMQWVKVPSKTYFEHNAAN
YLRHMPNVNRFFIVTDEGVADEGFADEITDIISKRRGQKEYEVFKAVTLDPNTDVIKDGV
HRMNIFKPDVVIAIGGGSVMDAAKAMRLFYENPEMSFEEAYQKFLDIRKRVVRFPKINGV
QLVCIPTTSGTGSEVSPIAIISDAKTGIKHTLCDYALTPDVSIVDDQFVQTLPKRLIAWS
GFEALGHAIESYVSTMATDFTRGWSLEAIKTIFANLKKSYDGDLDARKQMHDAATIAGMA
YSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALPQVIRFNSKRPEKLAMWPHYSVYRAKSD
YADIARAIGLTGSSDDELVEKLVQKIIDLAESVGIKMAYKDYGVDKAEFDKKVDELAVEA
YGDQNTVTNPTAPLISQIIQLMKDCYEGKGIVNNK
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacacagcaaaaacagactcttacagaggaagaaaagaaaaagcaaatctac
gacatggtagataacttagtaaagaaatcacatgttgcattagaccaaatggctaacttc
acacaagaacaagttgataagatctgtgaagcagttgctactgccggtgaacaaaatgct
tatccattggctaaaatggccgttgaagaaactaagcgtggtgtggtagaagacaaaact
actaagaatatgtacgctagtgaaaatatttggaatagtttacgtcacgaaaagactgtt
ggcgtaattgaggaagacaaggaattaggtttaaccaagattgctgaacctaagggtgtc
attgctggtgttactccagtaactaacccaacttcaactgttatttttaaagctatgctt
gctttaaagactagaaatacaattatcttcggcttccacccacaagctcaaaagtgttgt
gtagaaactggtaagattattcgtgctgctgctgttgccgctggtgctccagcagacgca
gttcaatggattgaagaaccaagtttagatgctactactgatttaatgaacaacccaggc
gttcaaactattttggctactggtggtccaggtatggttaaggctgcttattcatcaggt
aagccagctattggtgttggtcctggtaacggtccatcttacattgaaaagtcagctaac
atcgaccgtgctgtttatgacattgttttgtcaaagaacttcgataatggtatggtttgt
gcttctgaaaattcagttgttgtagacgacgaaatttacgacaaggttgttgatgaattc
aagaagtgggactgctacttcttaaacaaagaagaaattaagaagttcgaagaacacttc
atcgacccaagacgtggtactgttgcaggtcctgtagctggtaagtcagcttacgaaatt
gctaagctttgtggtgttgatgtaccaaagaacaccaaggtaatcgttgctgaatacaac
ggtgttggtagaaagttcccactttcagctgaaaagctttcaccagtattcactttgtac
cgtgctaagaatcatgacgatgccttcagaatttgttctgaacttcttgattacggtggt
cgtggtcacaccgctggtcttcactcaagcgacaagaagatcattgatgaatttgcaatg
aagatggatgcttgccgtatcttggttaactcaccagctgccctcggtggtatcggtgac
ctttacaacaacatgttgccatcacttactttaggtactggttcttacggtgccaacacc
ttctcacacaacattggtgctaaggacttgcttaacatcaaaacagttgctatgcgtcgc
gacaacatgcaatgggtaaaggttccttctaagacctacttcgaacacaacgcagctaac
tacttacgtcacatgccaaacgtaaatcgtttcttcatcgttactgatgaaggtgttgct
gatgaaggctttgctgatgaaattactgacatcatttcaaagcgccgtggccaaaaggaa
tacgaagtattcaaggctgtaactcttgatcctaacactgacgtgattaaagacggtgtt
cacagaatgaacatcttcaagccagacgttgtgattgctatcggtggtggttcagtaatg
gacgctgctaaggcaatgcgtttgttctacgaaaacccagaaatgagttttgaggaagct
taccaaaagtttttggacatcagaaaaagagtagttcgcttcccaaagattaacggcgtt
caacttgtatgtatcccaactacttcaggtactggttcagaagtttcaccaattgctatc
attagcgatgctaagactggtattaagcacactttatgtgattatgctttaactccagat
gtttcaattgttgatgaccaattcgtacaaactttaccaaagcgtttgatcgcttggtca
ggttttgaagcattaggccacgcaattgaaagttatgtttcaactatggctactgacttc
actcgtggttggtcacttgaagctatcaaaactatcttcgctaacttgaagaagtcatac
gatggcgaccttgacgcaagaaagcaaatgcatgatgccgcaactattgcaggtatggca
tactcaaacgccttccttggccttgaacactcaatcgctcacaccgttggatcaaccttc
gatattccaagtggcgtaagtgatgcaattgctttaccacaagttatccgcttcaactca
aagcgtcctgaaaaacttgccatgtggcctcactactcagtttaccgtgctaaaagtgac
tacgccgacattgctagagcaatcggtttgactggttcaagcgatgacgaattagttgaa
aagcttgtccaaaagatcatcgacttggctgaatcagttggcatcaagatggcttacaag
gactacggtgttgacaaggctgaattcgacaagaaagttgacgaattagctgttgaagca
tacggtgaccaaaacactgtaactaacccaactgctccacttattagccaaatcattcaa
ttaatgaaagattgctacgaaggcaagggtattgttaataacaaataa

DBGET integrated database retrieval system