KEGG   Lactobacillus amylovorus GRL 1112: LA2_03235Help
Entry
LA2_03235         CDS       T01371                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LA2_03235
   00052 Galactose metabolism
    LA2_03235
   00500 Starch and sucrose metabolism
    LA2_03235
   00520 Amino sugar and nucleotide sugar metabolism
    LA2_03235
Enzymes [BR:lam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LA2_03235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649351..650250
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIVIGKNK
RPIEDHFDSNPELEQDLAEKGKNELLKLTQGITNLGVNLYYTRQPHPAGLGDAIYRARSF
VGDEPFVVMLGDDLMDDETPLTKQLIDRYNKTHASTIAVMPVPHKEVSKYGVIEPENEIM
PGLINVKSFVEKPDIDKAPSDYAIIGRYLLTPEIFGILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKEQLRAYIQRLGKQFEAEDKAKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagctgttattcctgcagccggcttaggtactcgattcttacctgct
actaaggctttacctaaggaaatgctgccaatcgttgataaaccaactattcaatttatc
gttgaagaagctaagaagtctggtatcgaagatattttgatcgttatcggcaaaaacaag
cgcccaattgaagatcactttgattctaacccagaacttgaacaagacttagctgaaaag
ggcaagaacgaacttttgaaattaactcaaggcattactaatcttggcgttaatttatac
tacactagacaaccacatccagctggcttaggtgacgctatttaccgtgctcgcagtttc
gtaggggatgaaccatttgtcgttatgttaggtgacgacttgatggacgatgaaacgcca
cttactaagcaattgattgatcgctacaacaagactcatgcatcaaccattgccgttatg
ccagtaccacataaggaggtttcaaaatacggtgtaattgaaccagaaaacgaaattatg
ccaggtttgatcaacgttaagtcattcgttgaaaagccagacattgataaggcacctagt
gattacgcaattattggtcgctacctccttacaccagaaatttttggtattttagctcat
caaaaacctggtcgtggcggcgaaattcaattgactgatgccattgatacgatgaacaag
acgcaaagagtttttgctcatgtatttaagggtgaacgtcacgatgttggtaacaaggaa
ggctaccttgaaacttcaattgaatatggtttgaagcaccctgaaattaaggaacaactt
cgtgcttatattcaacgcttaggcaagcaatttgaagctgaagataaagccaaaaagtaa

DBGET integrated database retrieval system