KEGG   Lactobacillus amylovorus GRL 1112: LA2_03610Help
Entry
LA2_03610         CDS       T01371                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LA2_03610 (tpiA)
   01230 Biosynthesis of amino acids
    LA2_03610 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA2_03610 (tpiA)
   00051 Fructose and mannose metabolism
    LA2_03610 (tpiA)
   00562 Inositol phosphate metabolism
    LA2_03610 (tpiA)
Enzymes [BR:lam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LA2_03610 (tpiA)
Exosome [BR:lam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LA2_03610 (tpiA)
  Exosomal proteins of bladder cancer cells
   LA2_03610 (tpiA)
  Exosomal proteins of melanoma cells
   LA2_03610 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736189..736947
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGMDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSSLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaaattacacatgaacccagaacaaact
actgagttcgttgacgcagttaaggacaagttaccagatccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttgagaaaagctgctaagggttcaaacttg
cacatcggtgcagaaaactgctattttgaagacgaaggtgcttacactggtgaaacttca
cctaaggtcctcaaagaaatgggtatggactacgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgatgaagacattaacaagaaggctaaggcaatttttgctaat
ggcttaaagccaattatttgctgtggtgaatcacttgaaactcgtgaagctaacaagcaa
gaagactgggtagttgctcaaattaaggctgctttagatggtcttactgctgaacaagta
tcttcacttgtaattgcttatgaaccaatctgggctattggtactggcaagactgcttca
tcagaccaagctgaagaaatgtgcaagactattcgtgaaactgtaaaggacttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaagccagctaacgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system