KEGG   Lactobacillus amylovorus GRL 1112: LA2_04095Help
Entry
LA2_04095         CDS       T01371                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LA2_04095
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LA2_04095
Enzymes [BR:lam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LA2_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(820961..822103)
Genome map
AA seq 380 aa AA seqDB search
MKKKLLILTALATTALLITGCQHQIKANSRTTNFKTTAVKKKTNKIDLILKHMTLNEKIG
QLYFAHSTGNTKQMMQDVKKYHLGGTTLFAPDFQNKTKAQFDSEMRNYQKNSNHGLLIAT
DQEGGTVSRIDTNPSISQRKYPSPQEIYNTQGLTGIQKEDQTVAKILHQNGINMNFAPVA
DVAKDKNSFIYDRTLGQDYETTAKYIPVAVKSIQSQKVASCLKHFPGYGDAGDTHTGFAQ
INKPLSEYKKEDLLPFKAGIKAGVDEIMISHIVVKNIDTKMPASLSPAVHKLLRKNLAYQ
GLMITDDLQMGAITQYAKQHHINADVLALKAGNDMLLGGNYQTGILAIKKAVQKGTISQK
QINDSVRRILQLKEKLGILK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaactattaattttgactgctttagcgactacggcattattaattaccggt
tgccagcatcagataaaagctaacagtagaacaactaattttaaaactacggctgttaaa
aagaaaaccaataaaatcgatttgatccttaagcacatgactttaaacgaaaaaatagga
caattgtattttgctcatagtacaggcaacaccaagcaaatgatgcaagatgttaaaaaa
tatcacttgggcggtactactctatttgcaccggattttcaaaataagactaaggctcaa
tttgattcggaaatgcgcaattatcaaaaaaacagcaatcatggtttactaattgccacc
gaccaagaaggtggaacagtttcccgaattgataccaatcctagtatttcacaacgaaaa
tatcctagtccccaagaaatttataatactcaaggtctaactggcatccaaaaagaagat
caaacagtagctaaaattctgcatcaaaatggtataaacatgaattttgcccctgttgct
gatgttgccaaagataagaatagttttatttatgatcgaaccttaggacaagattatgaa
acaacagctaagtatattccagttgctgtcaaaagcatccaaagtcaaaaagttgctagt
tgtcttaaacactttccaggatacggagatgccggtgatactcataccggttttgcccaa
atcaataagccattgtctgaatataaaaaggaagatcttttaccttttaaggctggaatt
aaagctggcgtggatgaaatcatgatttcacacatcgtggtcaaaaatattgatactaaa
atgccggcatccctctccccagccgtgcacaaattactccgtaagaatttagcttatcaa
ggtctaatgattactgacgacttacaaatgggagcaatcactcagtacgctaagcagcac
cacattaatgccgacgttctggctctaaaagctggcaatgatatgcttttaggtgggaat
tatcaaaccggcatccttgctattaagaaagccgtacaaaaaggtacaatcagccaaaag
caaattaatgattcagttagaagaattttgcagttaaaagaaaagttaggcattcttaaa
taa

DBGET integrated database retrieval system