KEGG   Lactobacillus amylovorus GRL 1112: LA2_04335Help
Entry
LA2_04335         CDS       T01371                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lam03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
866068..868419
Genome map
AA seq 783 aa AA seqDB search
MVEFTGKVNGIVFENDKDLYKILDVEIIGSLENYSRDEIKVTGNFGDIQISTSYRFEGKL
VMHEKFGLQFRATSYKQVLPHEEGSLTKYLSSDKFPGIGKKAANTIIDELGLNALDILKE
KPAKIDTLSLTRKQKDSLLSGLNSMDSYSEIVLKLAQYGINRRIAANIYQLYHGDSLKKL
QTDPYAVINDVSGFGFKSADMLGKQLEIKDDDPRRINGAIYQVLIDALSGSGDTYVPLKE
LLIEASKLLQIDKFDPIANCVLGLQQDGKIVVNDDVAALQNIYQTEVDIAHSMKYLVESR
QDQEDEQYSEKEMNTAIKDAEKELKIKYDETQKLAIKNALNHPISILTGGPGTGKTTIIN
GILLALRKLAEIPASALYSEDPPFLLAAPTGRAAKRMSEITGIGAKTIHRMLGLGIGDAG
TGELNELNGEILIIDEMSMVDMFLFKQLLSSINQIRHIVFVGDKDQLPSVGAGNVFSDLI
KSQAFPTTILKEIHRQGDDSTIISLAHAVNEGVNEGALFKKTKNYSFISCRPDLVGDAVG
QIVELALKRGFAKDDIQVLGAMYHGNGGVDNLNDIIQEIMNPPKAKSKSLEAHNETFRIG
DRILQLQNNPEKDIYNGQIGKISSIDEENSKECMVAKFDDREVTFGRKDLNDLTRAYAIT
IHKSQGSEFPLVVLNLTMQNYVMLKRNLLYTAITRAEKNLVLVGDPRAFETAFKTPGNDR
KTGLASKLRKQLGITVKPENVQEPESKPKEKTKPKQPEDYILTPEKIYSGEIDPMIGMED
IHL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaatttaccggtaaggttaacgggatcgttttcgagaacgacaaggatttatat
aaaattttagatgttgaaattattggctcactagaaaactattcacgcgatgaaataaaa
gtgaccggtaattttggcgatattcaaatttcaactagttatcgttttgaaggcaaactt
gtgatgcatgaaaagtttggtttgcaatttagagctactagctataagcaggttttgccg
catgaagaaggttcattaactaaatatttgagttctgataaattcccaggcataggaaaa
aaggctgccaatacgattatcgatgagctaggcttaaatgctttggatattttaaaagaa
aaacctgctaagattgatactttatctttaactagaaaacaaaaagatagcttgctttct
gggctgaattcaatggattcttattcagaaattgtcttgaaattagcacagtacgggatc
aatcgtcgaattgcagctaatatttatcagttatatcatggcgacagtctaaagaaactg
caaacagatccttatgcagtgatcaatgatgtaagtggttttggttttaaatcagccgat
atgttgggtaaacagttagaaattaaggatgatgatccccgcagaatcaacggtgcgatt
tatcaggtgttgattgacgctttaagtggtagcggcgatacttatgtaccgcttaaggaa
cttctgatagaagcaagcaaactattgcaaattgataaatttgatcctattgctaattgt
gtccttggtttgcaacaagatggcaagatcgtagtcaatgatgatgtagcggctttacaa
aacatctaccaaacggaagttgatattgctcactcgatgaaatatttggttgaatccaga
caggatcaagaagatgaacaatatagcgagaaagagatgaacacagccattaaggatgca
gaaaaagaattgaaaattaaatatgacgaaacgcaaaaattagctatcaaaaatgcgttg
aatcatcctatttcaattttgactggtggccctggtacaggtaaaactacgattatcaac
ggaattttactagctttgagaaagctggctgaaatcccagcttctgctttgtacagtgaa
gatccaccattccttttggctgcacctactggccgtgcggctaagagaatgagtgagatt
actggtatcggtgctaaaacgattcacagaatgctgggattaggtattggggatgcaggc
actggtgaactaaatgaattaaacggtgaaatattaattattgacgagatgtcgatggtt
gatatgttcttgtttaaacagcttttgtccagtattaatcaaattcgccatattgtcttt
gtcggtgataaggatcagcttccatcagttggtgcgggtaatgttttcagtgatttgatt
aagtcgcaagcatttccaacaacgattttgaaagaaatccatcgacaaggtgacgattca
acgattatttcgcttgcccatgcggtcaatgaaggtgtgaatgaaggtgctttatttaag
aagacaaagaactattcatttatcagctgtcgaccagatttggtgggggatgcagttggt
caaattgttgaacttgctttaaagcgtggttttgctaaagatgatattcaagttttaggt
gcaatgtatcatggcaatggcggagtagataacttaaacgatattattcaagaaatcatg
aatccgcctaaggctaaaagtaagtcactggaagctcataacgaaactttccgaattggc
gacagaattttgcaattgcagaataatcctgaaaaagacatttataatggccaaatcggt
aaaattagcagtatcgatgaagagaactccaaagaatgcatggttgccaagtttgatgat
cgtgaagttacttttgggcgaaaagatttaaatgatttaactagggcctatgcgattaca
attcacaaatctcaaggttcagaatttccattagtagttctcaacctaacgatgcagaac
tatgtgatgctgaaacgaaatcttttgtatactgcaattacccgtgctgaaaagaatttg
gtgttagtaggagatcctagagcttttgaaacggcctttaaaacaccaggcaatgaccgt
aaaactggtctagcttccaaattacgtaaacaattaggcattacggttaaaccggaaaat
gttcaggaaccagagtcaaagccaaaagaaaaaacaaaacctaagcaaccggaggattat
attctaactcctgaaaaaatttattcaggtgaaattgatccaatgatcggtatggaagat
attcatttataa

DBGET integrated database retrieval system