KEGG   Lactobacillus amylovorus GRL 1112: LA2_04640Help
Entry
LA2_04640         CDS       T01371                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA2_04640
Enzymes [BR:lam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LA2_04640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925574..927055)
Genome map
AA seq 493 aa AA seqDB search
MAFTKKFTWGGATAANQYEGGYDEGGKGLNAVDVLTNGSATEPRKVTWKKPNGETGATPL
VWGKDFKLPEGAVPTLLDGYYYPSHQGTDFYHHYKEDIKYMADMGFDVFRLSMNWSRILP
NGDDEKPNEEGLAFYDKVFDECAKYGIQPLVTLSHYETPLSLITRFGGWKDRRLIDAFVH
YSDIVMNHYKGKVRYWLTFNEINAMDMAPYMGGGLIDGSEQNRAQGAHNQFVASAKVVKL
AHEIDPNNRVGQMLAYSAYYPYTCDPKDQLKVMEAKQDMLFYSDVQTGGHYPEYRLKKYE
RDGIKLDDTPEDYELIAKYPADFLSFSCYTSNVLTTHETEAKASGNVSAGGVKNPYLESN
AWGWATDPDVLRIALNDLWDRYHKPLWVVENGLGSADILEKDGKVHDDYRINYLRSQIKS
MRDAVTIDGVDLMGYTTWSAIDLVSNGTGEMKKRYGFVYVDRDDRGNGSLKRYPKDSFYW
YKKVISSNGEDLD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcattcacaaaaaaatttacttggggcggcgctaccgctgccaatcaatatgaaggt
ggttatgacgaaggcggtaagggtttaaacgccgttgatgttttaactaatggttcagct
actgaaccacgtaaagtaacttggaagaagcctaatggtgaaacaggtgctactccccta
gtttggggcaaagacttcaaactgcctgaaggtgcagttcctactctgcttgatggttac
tattatccaagtcaccaaggaactgacttctatcaccattacaaggaagatattaaatat
atggcagacatgggctttgatgttttccgtctttcaatgaactggtccagaattttgcca
aacggcgatgatgaaaagcctaacgaagaaggtttagcattttacgataaagtctttgat
gaatgcgccaaatatggcattcagcctttagttactttatctcactatgaaactcccctt
tctttaattacccgctttggcggatggaaagatcgtcgcttaatcgatgcttttgttcat
tattctgatatcgtgatgaaccactacaagggaaaggttcgttactggcttacctttaac
gaaattaatgcgatggatatggctccatatatgggcggtggcctaattgatggtagtgaa
caaaatcgggctcaaggcgctcacaatcaatttgtagctagtgctaaagtagttaaatta
gctcacgaaattgatccaaacaatcgtgtgggacaaatgttagcctactctgcttactat
ccatacacttgtgatcctaaagatcaacttaaagtaatggaagcaaaacaagacatgctc
ttttacagtgacgttcaaaccggtggacactatccagaatatcgtttgaagaaatatgaa
cgtgacggtattaagcttgacgatacaccagaagattatgaattaatcgctaagtaccct
gctgacttcttaagcttctcctgctacacttcaaatgttttaactactcatgaaactgaa
gctaaagcatctggtaatgttagcgcaggtggcgttaagaatccttaccttgaaagtaat
gcttggggttgggcaactgatccagatgtcttaagaatagctcttaatgacctttgggat
cgttaccacaagcctttatgggtagtcgaaaatggtttaggatctgccgatattttagaa
aaagatggcaaagtccacgatgattaccgcatcaattacttgcgtagtcaaattaaatct
atgagggatgccgttacaattgatggcgtcgatctaatgggctacactacttggtcagca
attgacctagtatctaacggcactggtgaaatgaaaaaacgctatggttttgtttatgtt
gatcgtgatgatcgcggcaatggatcacttaagcgttaccctaaggattcattctactgg
tacaaaaaagttatttcttccaacggcgaagatttagactaa

DBGET integrated database retrieval system