KEGG   Lactobacillus amylovorus GRL 1112: LA2_04705Help
Entry
LA2_04705         CDS       T01371                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LA2_04705
   00670 One carbon pool by folate
    LA2_04705
Enzymes [BR:lam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LA2_04705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939738..940244
Genome map
AA seq 168 aa AA seqDB search
MIEYVWAEDKKRQIGVDGHLPWHLPADLKHFKEKTMDHPILMGRKTFASLPKLLPGRKHI
VLTHNEEMKSKWKDNNQVEILTSIDEMNEYLSNHQSEKICAIGGVSIFKALLDQVDILEK
TEIEGAFKADTVMPEIDYSQFDLVHQEHHDADSKNKYPYTFLTYIRKH
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatatgtttgggcagaagataaaaaaagacaaattggcgtagatgggcacttg
ccttggcatttaccagctgacttaaagcattttaaagaaaagacaatggatcatccaatt
ttaatgggtaggaaaacttttgctagcttacccaagttattgccaggacgaaagcacatt
gttttgacccacaatgaagaaatgaaaagtaaatggaaagataataaccaggtagagatt
ttgacatcaatcgatgaaatgaatgaatatctttccaatcatcaaagtgaaaagatatgt
gcgattggtggcgtatcaatttttaaagccttgcttgatcaggttgatatccttgaaaaa
actgaaattgagggcgcctttaaagcagatacagttatgccagagattgattactcacag
tttgatttagtgcatcaagagcatcacgatgccgatagcaagaataaatatccttatact
tttttgacttatataagaaaacactaa

DBGET integrated database retrieval system