KEGG   Lactobacillus amylovorus GRL 1112: LA2_04705Help
Entry
LA2_04705         CDS       T01371                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lam00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lam00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939738..940244
Genome map
AA seq 168 aa AA seqDB search
MIEYVWAEDKKRQIGVDGHLPWHLPADLKHFKEKTMDHPILMGRKTFASLPKLLPGRKHI
VLTHNEEMKSKWKDNNQVEILTSIDEMNEYLSNHQSEKICAIGGVSIFKALLDQVDILEK
TEIEGAFKADTVMPEIDYSQFDLVHQEHHDADSKNKYPYTFLTYIRKH
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatatgtttgggcagaagataaaaaaagacaaattggcgtagatgggcacttg
ccttggcatttaccagctgacttaaagcattttaaagaaaagacaatggatcatccaatt
ttaatgggtaggaaaacttttgctagcttacccaagttattgccaggacgaaagcacatt
gttttgacccacaatgaagaaatgaaaagtaaatggaaagataataaccaggtagagatt
ttgacatcaatcgatgaaatgaatgaatatctttccaatcatcaaagtgaaaagatatgt
gcgattggtggcgtatcaatttttaaagccttgcttgatcaggttgatatccttgaaaaa
actgaaattgagggcgcctttaaagcagatacagttatgccagagattgattactcacag
tttgatttagtgcatcaagagcatcacgatgccgatagcaagaataaatatccttatact
tttttgacttatataagaaaacactaa

DBGET integrated database retrieval system