KEGG   Lactobacillus amylovorus GRL 1112: LA2_04985Help
Entry
LA2_04985         CDS       T01371                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LA2_04985
   01230 Biosynthesis of amino acids
    LA2_04985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LA2_04985
   00030 Pentose phosphate pathway
    LA2_04985
   00051 Fructose and mannose metabolism
    LA2_04985
   00052 Galactose metabolism
    LA2_04985
  Energy metabolism
   00680 Methane metabolism
    LA2_04985
Enzymes [BR:lam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LA2_04985
Protein phosphatases and associated proteins [BR:lam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LA2_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995903..996865
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHK
INEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFIVNVMGRECGDIAMRV
GVASGADAIVIPERPYDIKEIAETLKRGFADGKDHGIIVLAEGVMAADKFKDELLKYGDF
DARANVLAHMQRGGSPTVTDRVNATKMGNYAVKLLLDGKGGLAVGIENSKLETHDILDLF
DGKHQGDYALMDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagacgcccctggtatgaatgcagcaatt
agagctgtgacaaagactgccattcatcatggccttgaagtctttggaattcgttacggt
ttcgctggtttggttgcaggtgactttgttccgctaactacggaaaatgttgaccacaag
attaatgaaggcggtacattcttgtacagtgctcgtttccctgaatttgcacaagaagaa
gtgcaacaaaagggtgtagagcaattgaagaagcacggtatcgatgcagttatcgttatt
ggcggtgacggatcataccacggtgctttggccttaactcgccacggcgtaaactcagtt
ggtttgccaggaactatcgacaacgatattccttacactgactacacgatcggctttgat
tctgcttgtcgtactgctatggacgcaattgataagattcgtgacactgcaagtagtcac
cacagagtattcattgttaacgtaatgggtcgtgaatgtggtgatattgctatgcgtgtt
ggtgttgcaagcggcgcagatgctattgtaattcctgaacgtccttatgacattaaggaa
attgcagaaactcttaaacgcggatttgcagatggcaaagatcatggtatcattgtctta
gcagaaggtgtcatggctgccgataaatttaaggatgaattacttaaatacggtgacttt
gatgcccgtgctaatgtccttgcacatatgcaacgtggtggctcacctactgtcacagat
agagtaaatgctactaagatgggtaactatgctgttaagttgcttcttgatgggaagggc
ggtttagctgtcggcatcgagaatagcaaacttgaaacccacgacattcttgatttgttt
gatggtaaacaccaaggcgactatgcgcttatggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system