KEGG   Lactobacillus amylovorus GRL 1112: LA2_06820Help
Entry
LA2_06820         CDS       T01371                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LA2_06820
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LA2_06820
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LA2_06820
Enzymes [BR:lam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LA2_06820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302408..1303898
Genome map
AA seq 496 aa AA seqDB search
MKYRSTRGAKDNALTSPAAIIQGLAQDGGLYVPVDFPKANFQLEDLPKLSYKQISAMIIS
LFFDDFSKDQIKFAVINAYSEQWDDRSIVPIEKHNDNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKIDRDIIILTATSGDTGTASMRGFANQKGTRVIVFYPEGGVSPVQLKQMLS
QHGDNLEAIAIKGNFDDAQTEVKKIFNDENFRKKLNQNGFQFSSANSMNIGRLVPQISYY
LYTYGQLVRRREINLGDKVNFTVPTGNFGDILAGYYAEKLGLPINKLICASNENNVLTDF
FAKGEYDKRRKFHLTNAPAMDILVSSNLERLLFDLYDKDNEKIASLMNQLTQRGHYQVDK
EVLDKLQTIFAAGFATEDEVKEEIHRVYNYDRYVIDPHTAVGSYVAQQYKSKTNDQTPMV
IVSTASPYKFPETVYEAITGRVCPQTGVAAIKKLHDELGGQLSIGVRTLFDHEPHVEKVI
DPVNMEAAISSILDLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactcgaggcgcaaaagacaatgcgttaacttcaccagccgcaatc
atccaagggttggcccaagatggtggactttatgtaccagtagattttccaaaagctaat
tttcaactagaagatttacctaagttatcttataagcaaatttcagcaatgatcattagc
ttattttttgatgatttttctaaggatcaaattaaatttgcagtaatcaatgcttatagc
gaacaatgggacgaccgcagcattgtgccaattgaaaaacacaacgataatttttacatg
gaactctttcacggtccaactttagcttttaaagatattgctttgcagatgttaccacag
ctaatgacacgtgcagtacaaattgagaaaatcgatcgtgacatcattatcttgactgct
acttctggtgacaccggaactgcttcaatgcgcggctttgctaaccaaaaaggtacacgc
gtcatcgtcttctatcctgaaggcggcgttagccctgtccaacttaaacaaatgctcagt
caacacggcgacaatttggaagccatcgcgatcaagggtaactttgacgatgcgcaaact
gaagtaaagaagatttttaacgatgaaaacttcagaaagaaactaaaccaaaacggtttc
caattctcatctgctaactcaatgaacattggtcgtcttgttcctcaaatttcttattac
ctttacacttatggtcaattggttcgccgtcgtgaaatcaacttgggcgacaaagtaaac
tttaccgtacctacaggcaatttcggcgacattttagctggttactatgcagaaaaactc
ggtttgccaatcaacaaattgatctgtgcttcaaatgaaaacaacgttcttactgacttt
tttgccaaaggtgaatacgacaagcgtcgtaagttccatttaactaacgcaccagcaatg
gatattttagtttcaagcaatctagaacgacttttattcgatttatatgataaagataat
gaaaaaattgctagtctaatgaatcaattaacgcaaagaggtcattaccaagtcgacaaa
gaggtcttagacaaattacaaaccatttttgcggctggttttgccactgaagatgaagta
aaagaagaaattcaccgcgtctacaattatgatcgctacgtaattgatcctcatactgca
gtaggttcatacgttgctcagcaatataagagcaagacaaacgatcaaacaccaatggtg
attgtgtctactgctagtccttataagttccctgaaaccgtttatgaggctattacaggt
agagtttgtcctcaaactggcgtagctgctattaagaagttgcatgatgaattgggtggt
caattatccatcggtgtacgcaccttgtttgaccacgaaccacacgttgaaaaagtaatt
gatccagtcaacatggaagcagctatcagttcaattttagatttaaagtaa

DBGET integrated database retrieval system