KEGG   Lactobacillus amylovorus GRL 1112: LA2_08275Help
Entry
LA2_08275         CDS       T01371                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LA2_08275
Enzymes [BR:lam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LA2_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1562512..1563954)
Genome map
AA seq 480 aa AA seqDB search
MPIKNKVMLITYPDSLGKNLQELSEVLENDLKEAVGGIHLLPFFPSTGDRGFAPTDYTTV
DPKFGNWSDVEKLGEKYYLMFDFMINHISRHSKYYEDFQKNKDKSPYADMFLSWDKFWPK
GRPTKEDVDLIYKRKDRAPYQEITFADGSKEKLWNTFGPEQIDLDVRKKVTQKFIKDTLV
SLIKHGADIIRLDAFAYAVKKLDTNDFFVEPEIWNLLKQVQDDIADEGATILPEIHEHYS
MPFKISKHDYFIYDFALPMVTLYSLYSGKSNRLAAWLKKCPMKQFTTLDTHDGIGVVDAR
DILSPEEIDYTSQELYKVGANVKKKYSSAEYHNLDIYQINTTFYSALGDDDKRYFMARLL
QVFAPGIPQVYYVGMLAGKNDIKLLEETKEGRNINRHYYSKAEVEQEIQRPVVASLLKLF
TFRNNEPAFDLNGSIDISTPNENEIRIVRINKEQNHKAELTANLQDLTYRVLVNGKQINF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaaaaataaagtaatgttgattacctatccagatagtttaggtaaaaactta
caggaattaagtgaagtcttagaaaatgatttaaaagaagccgttggcggcattcattta
ctgccattctttccttcaacgggtgatcgcggctttgcaccaactgattacacgacagtt
gatcctaaatttggtaattggtcagatgttgaaaagttgggcgaaaaatactacctgatg
tttgattttatgatcaatcatatttctaggcattctaagtattacgaagattttcaaaag
aataaggacaaaagtccatatgcagatatgttcttaagttgggataagttttggccaaaa
ggtcgtccaactaaagaagatgtggacctaatctataagcgtaaagatcgtgctccatat
caagagattacttttgcggatgggagcaaggagaaactttggaatacttttggtcctgag
caaatcgatttagacgtgcgcaaaaaggttacgcaaaagtttattaaggacacgttggtt
agcctaattaagcacggagcagatatcattcgtttggatgcttttgcttatgctgtgaaa
aaactagatactaatgacttctttgtagaaccagaaatctggaatttgcttaagcaggta
caggatgatattgctgatgaaggagcaacgattttgccagaaatccatgagcattattct
atgccgttcaagatttcaaaacatgactactttatctacgactttgctctaccaatggtt
actctgtattcgctttattcaggtaaatccaatcgtttggcagcttggctaaagaaatgt
ccaatgaagcaattcactaccttggatactcatgatggtattggcgtagttgatgcgcgt
gatattctttctccagaagagatcgattataccagccaagaactttataaagttggtgct
aatgttaagaaaaagtattcaagtgctgaatatcataatttggatatttatcaaattaat
actactttttattcagctttgggcgatgacgataaaagatacttcatggcaagattattg
caggtctttgctcctgggattccgcaggtctactatgttgggatgttagctggcaagaat
gatattaagctccttgaagaaactaaagagggaagaaatattaatcgtcattattacagc
aaagctgaagttgaacaagaaattcagcgacctgttgttgcctctttgttgaaactcttt
acttttagaaacaatgaacctgcatttgacttaaatggttctattgatatctctacccct
aatgaaaatgaaatccgtattgttcgaatcaataaagaacaaaatcataaagcagaatta
actgctaacttacaagatttaacttaccgagttttggttaacggtaagcaaatcaacttt
taa

DBGET integrated database retrieval system