KEGG   Lactobacillus amylovorus GRL 1112: LA2_08345Help
Entry
LA2_08345         CDS       T01371                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lam00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1579664..1581670)
Genome map
AA seq 668 aa AA seqDB search
MTKTLSRFLYGGDYNPDQWTEETWPEDIKVFKKVDLNSATINIFSWAVLEPREGVYDFSK
LDKIVQELSDANFDIVMGTATAAMPAWMFKKYPDIARVDYQGRRHVFGQRHNFCPNSKNY
QRLDSELVEKLAQHYADNSHIVVWHVNNEYGGNCYCGNCQNAFRDWLRNKYKTLGALNKA
WNMNVWSHTIYDWDEIVVPNELGDAWGPESSETIVAGLSIDYLRFQSESLQNLFKMEKAV
IKKYDPETPVTTNFHSLPNKMIDYQKWAKDQDIISYDSYPTYDAPAYKPAFLYDLMRSLK
HQPFMLMESAPSQVNWQSYSPLKRPGQMAATELQAVAHGADTVQFFQLKQAVGGSEKFHS
AIIAHSQRTDTRAFCELADLGQKLKEAGPTILGSKTKAKVAIVFDWSNFWSYEYVDGITQ
DLNYVDSILDYYRQFYERNIPTDIIGVDDDFSNYDLVVAPVLYMVKAGLAEKINSYVEKG
GHLVTTYMSGMVDSTDNVYLGGYPGPLKDVTGIWVEESDAMVPGQKVRVTMDGKEYETNL
MCDLIHPNKAKVLASYADEFYTGTAAITENDYGKGKAWYVGTKLGHQGLTQLFNHIVLET
GVESLVCDSHKLEVTKRVTADGKELYFVLNMSNEERELPNKFADYEDILTGEKAKSSMKG
WDVQVLTK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacattatcacgttttctttatggtggggactacaatcccgatcaatggaca
gaagaaacatggcctgaagacattaaggtctttaaaaaggtagatttaaattcagctaca
attaatattttctcttgggcagttcttgaacctagagaaggagtctatgacttttctaaa
ttagacaagatcgttcaagaattatctgatgcaaactttgatattgtgatgggtacggca
acagccgcaatgccagcctggatgtttaaaaagtatccggatatcgcaagagttgattac
caaggcagacgtcacgtctttggtcagcggcacaatttctgtccgaacagcaagaattat
caaagactggatagtgagttagttgaaaaattggcccagcactacgctgacaattcgcat
atcgtagtttggcacgtgaacaatgaatacggtggcaactgctactgtggaaattgtcaa
aacgccttccgtgactggttgagaaacaaatacaagaccttgggtgcgctcaacaaggct
tggaacatgaatgtttggagtcacacgatttatgactgggatgaaattgttgttccaaac
gagttgggggatgcatggggtccagaaagtagcgaaaccattgttgctggcctttcaatc
gactacttgcgctttcaatccgaaagtttgcaaaacctcttcaagatggaaaaggcagtc
atcaagaagtacgatcctgaaacgcctgtaactactaacttccacagtttgccaaacaag
atgattgactatcaaaagtgggccaaggatcaagatattatttcctatgatagttatcca
acttacgacgcacctgcttataagccagcattcttgtatgacttaatgagaagccttaag
catcaaccatttatgttaatggaatctgcaccttcacaagttaactggcaatcttacagt
ccactaaagcgtccaggtcaaatggccgcaactgaattgcaagctgttgctcacggtgct
gacactgttcagttcttccaattaaagcaagcagtgggtggttccgaaaaattccacagt
gcaattattgctcattcacaaagaactgatactagagccttctgtgaattggctgatttg
ggtcaaaaattaaaggaggctggtccaacaatcttaggttcaaagactaaagctaaagtc
gcaattgtctttgattggagcaacttctggtcatacgaatatgttgatggcattactcaa
gatttgaattatgttgactcaattttggactactaccgtcaattctatgaacgcaacatt
ccaaccgatattattggtgttgatgatgactttagtaactatgacttggttgttgcacca
gtgctttacatggttaaagcaggtttagctgaaaagatcaacagctatgttgaaaagggc
ggccacctcgttactacctacatgtcaggtatggttgattcaactgacaatgtttacctt
ggcggttatcctggtccattgaaagatgtcaccggcatctgggttgaagaaagcgacgca
atggttccaggtcaaaaagttagagtcacgatggatggcaaagaatacgaaactaactta
atgtgtgatttgattcatccaaataaggccaaagttttggcaagctacgctgatgagttt
tacactggcactgctgcgattactgaaaatgattatggcaaaggcaaggcttggtacgtt
ggaaccaagttaggtcaccaaggtttgacacaattattcaaccacattgtgcttgaaact
ggagttgaatcattagtttgcgacagccataagcttgaagtaactaagcgtgtcacagca
gatggcaaggaactttacttcgtgcttaacatgagcaatgaagaaagagaattgccaaat
aaatttgcggattatgaagacatcttaactggtgaaaaagctaagagttcaatgaaagga
tgggatgtccaagtcttaaccaagtaa

DBGET integrated database retrieval system