KEGG   Lactobacillus amylovorus GRL 1112: LA2_09485Help
Entry
LA2_09485         CDS       T01371                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LA2_09485
   00052 Galactose metabolism
    LA2_09485
   00500 Starch and sucrose metabolism
    LA2_09485
   00520 Amino sugar and nucleotide sugar metabolism
    LA2_09485
Enzymes [BR:lam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LA2_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1813743..1814618)
Genome map
AA seq 291 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKASGIEDILIVTGKNK
RAIENHFDSNPELEQDLEKTGKSGLLKLTQEITDLGVNLYYTRQPHPAGLGDAVYRARSF
VAGEPFVIMLGDDLMKDKVPLTKQLINDYDKTHASTIAVMKVPHKEVSKYGVIAPDGKIA
DDLYNVKSFVEKPDVDKAPSDLAIIGRYLLTPEIFDILEHQKPGRGGEVQLTDAIDTMNK
TQRVFAQVFKGQRFDVGNKEGYLETSIQYGLKHPETRDALRKYIKELSKTL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcgattatccctgcagcaggattaggcactagatttttgccagca
actaaggcattgcctaaggaaatgttgccaattgttgacaagccaacgattcaatttatc
gtggaagaagctaaggcttcaggaatcgaagatatcttgatcgttaccggtaaaaacaag
cgtgcgattgaaaaccatttcgactctaatcctgaattggagcaagacttggaaaagacc
ggtaagtctggtttgctcaagttaacacaagaaattactgatttgggcgtaaacttgtac
tacactcgtcaaccacacccagctggcttgggggatgccgtctaccgcgcacgtagcttc
gtagctggtgaaccattcgtgattatgcttggcgacgacttgatgaaggacaaggtgcct
ttgactaagcagttaattaacgattacgacaagactcatgcttcaactattgccgttatg
aaagtaccacacaaggaagtttctaagtatggtgtaattgcaccggatggtaagattgcc
gatgacttgtacaatgtaaagagttttgtggaaaaaccagatgttgataaagctccaagt
gatcttgcaataatcggtcgttacttattaacgcctgaaatttttgacattttggaacat
caaaagccaggtcgtggtggtgaagttcaattaactgacgccattgatacaatgaataag
acacaacgtgtatttgctcaagtgtttaaaggtcaacgtttcgatgttggtaacaaggaa
ggctatcttgaaacttccattcaatatggtttgaagcaccctgaaacgcgtgatgcctta
cgcaagtatattaaggaattaagcaagacattataa

DBGET integrated database retrieval system