KEGG   Lactobacillus amylovorus GRL 1112: LA2_09810Help
Entry
LA2_09810         CDS       T01371                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
lam00230  Purine metabolism
lam01100  Metabolic pathways
Module
lam_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lam00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LA2_09810
Enzymes [BR:lam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LA2_09810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ABC_tran AAA_33 AAA_16 AAA_22 AAA_14 ATPase AAA_17 RsgA_GTPase AAA_24 Thymidylate_kin Zeta_toxin AAA_29 PRK AAA_23 Rad17 dNK AAA_5 APS_kinase PduV-EutP T2SSE MMR_HSR1 AAA CPT
Motif
Other DBs
NCBI-ProteinID: ADQ59867
UniProt: E4SMX1
Position
complement(1867134..1867682)
Genome map
AA seq 182 aa AA seqDB search
MKKIILIAGPSGAGKTTISDYLYEKYDIPRVLTHTTRPMRVGERQNVSYHFETDDSFKKL
HFFEHVKYGSYQYGSSREALNLAWKKHDLVSLIVDIQGVYSYIKQLGDKVYFLYVTTSTK
EELKERLLKRGDDPEKIKERLSGSELNLLPADLKQYAHVIVNDNLNKTKETLNSIISRLE
ED
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataattttaattgcgggaccaagtggtgctggcaagacgaccatttccgat
tatttatatgaaaaatatgacattccgcgcgttttaacgcataccacacggccaatgcgt
gtcggcgaaaggcagaatgtgtcatatcactttgaaacagatgattcatttaagaaatta
cacttctttgaacatgtaaaatacggttcatatcagtatggttcaagtcgtgaagcatta
aacctcgcttggaaaaaacacgatctggtgtcattaatcgtcgatattcaaggcgtatat
tcttacattaaacaattaggtgacaaagtttatttcttatatgtcacaacttcgactaaa
gaagagctaaaagagcggctgctcaagcgtggcgacgatcctgagaagattaaggaacgc
cttagtggtagcgaattaaacttgcttccagcagatttgaaacaatacgctcatgtaatt
gttaacgataatcttaacaaaactaaagaaacgttaaactcaatcatatcaaggcttgag
gaagactag

DBGET integrated database retrieval system