KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0179Help
Entry
Lacal_0179        CDS       T01533                                 

Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lacal_0179
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lacal_0179
  Amino acid metabolism
   00310 Lysine degradation
    Lacal_0179
Enzymes [BR:lan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Lacal_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(189055..190368)
Genome map
AA seq 437 aa AA seqDB search
MARFELKLPKMGESVAEATITSWLKEVGDTIEQDEAVLEIATDKVDSEVPSEVDGVLVEV
LFNVDDVVQVGQTIAVIETEGEGNTTATEPKAEEVVEEKTAPAVAEVEKTVTKAQETAAP
ISSNGERFYSPLVKNMAKAEGIGQAELDAITGTGKDGRVTKADMQAYLKNRGSQPAQAAA
APAPAKTSKPEAKKAAPVVAAQGDEIIEMTRMGKLIAHHMVDSVQTSAHVQSFIEADVTN
IWNWRKKVKGEFMKREGENLTFTPIFMEAVAKALRDFPMMNISLQGDTIVKKKNVNLGMA
AALPDGNLIVPVIKNADQLNLVGMTKAVNDLAGRARDNKLKPDDIQGGTYTVTNVGTFGS
IMGTPIINQPQVGILALGAIRKVPAVIETPDGDFIGIRYKMFLSHSYDHRVVNGALGGQF
VKAVKDYLEAWDSNREI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaactaaaattaccgaaaatgggagaaagcgtagcagaagctacgatt
acttcatggttaaaagaagttggagatactattgaacaagacgaagcagttttagaaatt
gcaacagataaagtagatagtgaagtaccaagtgaagttgatggtgttttagtagaagtg
ctttttaatgtagacgatgtagtacaagtaggccaaacaattgctgtgatagaaacagaa
ggtgaaggtaatacaaccgctacagagccaaaagcagaagaagttgtagaagaaaaaacg
gcacctgcagttgcagaggttgaaaaaacggtgactaaagctcaagaaacagcagcgcca
ataagttctaatggcgaacgtttttactctccattagtaaaaaatatggctaaagccgaa
ggtattggtcaagccgaattagatgctattacaggaacaggaaaagatggtcgtgtaact
aaggcagacatgcaagcttatttaaaaaatagaggttcgcaacctgcacaagcagcagca
gcaccagcaccagctaaaacctctaagcctgaagctaaaaaagcagcgccagttgtagca
gcacaaggtgatgaaattatagaaatgactagaatgggcaagcttattgcgcatcatatg
gtagatagtgtacaaacaagtgcacacgtacaaagttttatcgaggccgatgttacaaat
atctggaactggagaaagaaagtaaaaggagaatttatgaaacgtgaaggcgaaaacctt
acgtttacgccaatatttatggaagccgttgcaaaagcattacgtgattttcctatgatg
aatatctctttacaaggcgatacaattgttaaaaagaaaaacgtaaaccttggtatggca
gcagctttaccagatggaaatttaattgtaccagttattaaaaatgcagaccaacttaac
ctagttggcatgacaaaagctgtaaacgatttagcaggacgcgcaagagataataaatta
aaaccagacgatatacaaggcggaacatatactgtaacaaatgttggtacatttggtagt
attatgggaacaccaataattaaccagccacaagtaggtattttagctttaggtgctata
cgtaaagtgcctgcagttatagaaacaccagatggcgattttataggtatacgttataaa
atgtttttatcacactcttacgatcacagagttgtaaatggagcacttggtgggcagttt
gtaaaagcagtaaaagactatttagaagcttgggattctaatagagaaatataa

DBGET integrated database retrieval system