KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0181Help
Entry
Lacal_0181        CDS       T01533                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lacal_0181
DNA repair and recombination proteins [BR:lan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lacal_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(191587..192309)
Genome map
AA seq 240 aa AA seqDB search
MLKNTKILHGVTLNINVFKDTKISESLHLYLNSQSMEFSSKLLENAVNEISQLPGIGKRT
ALRLALHLLKQPKEQTTNLSQAITHMREDLKFCRSCHNISDVDLCEICANPLRKKDVICV
VEDIRDVMAIENTASHKGLYHVLGGKINPIEGIGPHDLNIVSLIEKVKSGNIKELIFALS
PTMEGDTTNFYIFKQLQGLEVQTSTIARGISVGDELEYADEVTLGRSILNRIPFENSLKQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaaaaatactaaaatattacatggtgttactttaaatattaacgtatttaaagac
actaaaattagtgaaagtctgcacttatatttaaattcgcagtctatggaattctcatct
aaacttttggaaaatgctgttaacgaaatctcacaattaccaggtattggtaagcgtaca
gcattacgtttggcattacatttattaaaacaaccaaaagagcaaaccacaaatttatcg
caagcaattactcatatgcgagaagatttaaaattttgtagatcctgccataatattagc
gatgttgacttgtgtgaaatttgcgcaaatccattgcgaaaaaaagatgttatttgtgta
gttgaagatattcgcgacgttatggctatagaaaatacggcatcgcataaaggattgtat
cacgttttaggcggaaaaataaatcctatagaaggtattggaccacacgatttaaatatt
gtaagcttaatagaaaaagtaaaaagcggaaacattaaagaacttatttttgcattaagc
ccaactatggaaggcgatacaaccaacttttatatatttaaacaattacaaggtttagaa
gtacaaacctctacaatagccagaggaatatctgttggagatgagttagagtatgcagat
gaggtaacacttggacgcagtattttaaatcgtattccgtttgaaaactcattaaaacaa
taa

DBGET integrated database retrieval system