KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0194Help
Entry
Lacal_0194        CDS       T01533                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00620  Pyruvate metabolism
lan00630  Glyoxylate and dicarboxylate metabolism
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01120  Microbial metabolism in diverse environments
lan01200  Carbon metabolism
Module
lan_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lacal_0194
   00630 Glyoxylate and dicarboxylate metabolism
    Lacal_0194
Enzymes [BR:lan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Lacal_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEH00047
UniProt: F6GIJ9
Position
209640..211238
Genome map
AA seq 532 aa AA seqDB search
MENTLLKSHKITFSKEVKNYYPEILTDDAFNFLTALHEKFNSKRLELLKRREQQQLVFDT
GKFPNFPIETKTIRESDWTAGNIPHDLQDRRVEITGPVNRKMIINALNSGAKTFMADLED
SNAPTWKNTIDGQQNLMDANNKTIALVDTKRNKSYKLNNKTAVLLVRPRGLHLNERHILI
NNQETSGSLVDFGLYVFHNAATLLKNNTAPYFYLPKLEHYLEARWWNEVFAFAQDYLKIP
LGTFKATVLVETITASFQLDEIIYELKDHIVGLNCGRWDYIFSYIKKFRNHSNFVVPNRD
QVTMETPFMDAYSKLVIQRCHKRGILAIGGMAAQIPIKNNEQANANALEKVRKDKEREVK
NGHDGTWVAHPALVNVALNEFNKHMPNANQLHITRDDINITEHDLVQLPKGTITEAGIRK
NINVGILYTEAWLRGHGAVALYNLMEDAATAEISRTQIWQWLKNKVIIEDGREFNQAFYN
ELFNDEVEKIITEIGEENIKNTKFKLAIDLFNSLVLAETFEEFLTLPAYQYI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacacgcttttaaaatcgcacaaaattactttctctaaagaagtaaaaaattac
tatccagaaattttaaccgatgatgcttttaactttttaactgcgcttcacgaaaaattt
aattctaaacgtttagaacttttaaaaagaagagaacaacagcagttagtttttgataca
ggtaaatttccaaactttccaatagaaaccaaaactataagagaaagcgactggacagca
ggaaacataccacacgatttacaagatagacgtgtagaaattacaggacctgttaataga
aaaatgataattaatgctctaaactctggcgccaaaacctttatggcagatttagaagac
agcaatgcgcctacctggaaaaatactattgacggacaacaaaacttaatggatgccaac
aacaaaaccattgctttagtagatacaaaaagaaataaatcttacaagctaaataacaaa
accgctgtattattagtaagacctagaggtttgcatttaaatgaaaggcatattttaatt
aacaaccaagaaacctcaggaagtttggtagattttggtttatatgtttttcataacgca
gcaacactattaaaaaacaatacagcaccttacttctatttaccaaaattagaacattat
ttagaagcgcgctggtggaatgaggtttttgcttttgctcaagactatttaaaaatacct
ttaggtacatttaaagcaacagttttagtagaaacaataactgcaagctttcaattagac
gagattatttacgaattaaaagatcacattgtaggcttaaactgtggacgttgggattat
attttttcatatatcaaaaagtttagaaaccactctaactttgttgttcctaatcgcgat
caagtaacaatggaaacaccgtttatggacgcttactctaagttagtaatacaacgttgc
cataaaagaggcatactagcaattggcggtatggctgctcaaattcctattaaaaataac
gaacaagccaatgctaatgcattagaaaaagtaagaaaagataaagaacgtgaagtaaaa
aacggccacgatggtacttgggttgcgcatcctgctttagttaatgttgcgttaaatgag
tttaataaacacatgccaaatgcaaaccaattacacataacaagagatgatattaatatt
acagaacatgatttagtgcaattaccaaaaggtacaataactgaagctggtattagaaaa
aacattaatgtaggcattttatataccgaagcttggctacgcggtcatggagctgttgca
ctgtataacttaatggaagatgctgctacagcagaaatttcacgaacacaaatttggcag
tggttaaaaaataaagttattattgaagatggtcgcgaatttaaccaagcgttttacaat
gagttatttaatgatgaagttgaaaaaataattaccgaaattggagaagaaaacataaaa
aacacaaagtttaaacttgctatagacctttttaactctttagttctcgcggaaacattt
gaagaatttttaacacttccagcttaccaatacatttaa

DBGET integrated database retrieval system