KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0195Help
Entry
Lacal_0195        CDS       T01533                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:lan01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:lan00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211312..212934
Genome map
AA seq 540 aa AA seqDB search
MKNLAQTNYSSALETVRSLKAKYGNTWDAILPESAARMAIQNRFKTGLDIAKYTAAIMRK
DMAEYDADTTKYTQSLGCWHGFVAQQKMIAVKKHHQTTNKKYLYLSGWMVAALRSEFGPL
PDQSMHEKTAVPELIAEIYDFLRQADAIELNDLFRRLENGEDVQDKIDNFETHIVPIIAD
IDAGFGNEEATYLLSKKMIQAGACAIQIENQVSDAKQCGHQDGKVTVPHEDFIAKLNAVR
YAFLELGIEDGIIVARTDSEGAGLTQKLPVSQKPGDLASQYLAFVEAEEIDINNAKEDDV
LLKRDGKLVRPVRLANGLYKFRDGTNIDRVVLDCVTSLQNGADLLWIETPTPNVKQIAHM
VNRVRETIPNAKLVYNNSPSFNWTLNFRNQAYDAMLLEGKNLTAYDRNNLMAEEYDNSEL
SLRADQNIKTFQADASREAGIFHHLITLPTYHTTALHMNNLTQGYFGKEGMLTYVKEVQR
QEIRKGVSCVKHQRMAGSDLGDDHKTFFAGEKALKASGENNTSNQFENTTKTTPFINIAV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttagcacaaacaaattatagctctgcgctagaaacagtaagaagcctaaaa
gctaaatatggaaatacctgggatgcaatattaccagaaagcgctgcaagaatggcaata
caaaatagatttaaaacaggtttagatattgctaaatataccgctgccattatgagaaaa
gacatggcagagtacgatgcagacactacaaaatacacgcaatctttaggttgttggcat
ggttttgttgcccaacaaaaaatgatagctgttaaaaaacatcaccaaactacaaacaaa
aaatacttatacctttctggttggatggttgctgcattacgttcagagtttggcccatta
ccagaccaatctatgcatgaaaaaactgctgtacctgaattaattgcagaaatttatgat
ttcttgcgtcaagcagatgctatagaattaaacgatttatttagacgcttagaaaatggt
gaagacgtacaagacaaaatagataatttcgaaactcacattgtacctattatagcagat
attgatgctggttttggtaatgaagaagcaacctatttattatcaaaaaaaatgatacaa
gctggtgcttgtgcaatacaaattgaaaaccaagtatctgatgctaaacaatgcggtcac
caagatggcaaagttaccgtaccacatgaggattttatagcaaaactaaatgcagtaaga
tatgcttttttagaattaggtattgaagacgggattatagttgctagaacagattctgaa
ggtgcaggattaacacaaaaacttcctgtaagtcaaaaacctggagatttagcatcacaa
tatcttgcctttgttgaagcagaagaaattgatattaataatgctaaagaagatgatgtt
ttacttaaaagagatggtaaacttgttagacctgttcgtcttgccaatggcttatataaa
tttagagatggtaccaatattgaccgtgttgtattagattgtgtaactagcttacaaaat
ggagcagatttattatggatagaaacaccaactccaaacgttaaacaaatagcgcatatg
gttaatagagtgcgcgaaacaattccaaacgcaaaattggtatacaataattcaccatca
tttaactggactttaaattttagaaatcaagcatatgatgctatgcttttagaaggaaaa
aaccttacggcatatgatagaaacaatttaatggctgaagagtatgataattcagagtta
agtctgcgtgcagaccaaaatataaaaacgtttcaagcagatgcatcaagagaagccgga
atatttcaccacttaataaccttaccaacttatcacacaactgcgttgcatatgaataat
ttaactcaaggatactttggtaaagaaggcatgttaacttatgtaaaagaagtacaacgt
caagagattagaaaaggcgtatcatgcgtaaaacaccaaagaatggcaggatctgattta
ggtgatgatcataaaacattttttgcaggagaaaaagcactaaaagctagcggagaaaat
aacacatcaaaccaatttgaaaacactactaaaactactccttttataaatattgcagta
taa

DBGET integrated database retrieval system