KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0195Help
Entry
Lacal_0195        CDS       T01533                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lacal_0195
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lacal_0195
Enzymes [BR:lan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Lacal_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211312..212934
Genome map
AA seq 540 aa AA seqDB search
MKNLAQTNYSSALETVRSLKAKYGNTWDAILPESAARMAIQNRFKTGLDIAKYTAAIMRK
DMAEYDADTTKYTQSLGCWHGFVAQQKMIAVKKHHQTTNKKYLYLSGWMVAALRSEFGPL
PDQSMHEKTAVPELIAEIYDFLRQADAIELNDLFRRLENGEDVQDKIDNFETHIVPIIAD
IDAGFGNEEATYLLSKKMIQAGACAIQIENQVSDAKQCGHQDGKVTVPHEDFIAKLNAVR
YAFLELGIEDGIIVARTDSEGAGLTQKLPVSQKPGDLASQYLAFVEAEEIDINNAKEDDV
LLKRDGKLVRPVRLANGLYKFRDGTNIDRVVLDCVTSLQNGADLLWIETPTPNVKQIAHM
VNRVRETIPNAKLVYNNSPSFNWTLNFRNQAYDAMLLEGKNLTAYDRNNLMAEEYDNSEL
SLRADQNIKTFQADASREAGIFHHLITLPTYHTTALHMNNLTQGYFGKEGMLTYVKEVQR
QEIRKGVSCVKHQRMAGSDLGDDHKTFFAGEKALKASGENNTSNQFENTTKTTPFINIAV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttagcacaaacaaattatagctctgcgctagaaacagtaagaagcctaaaa
gctaaatatggaaatacctgggatgcaatattaccagaaagcgctgcaagaatggcaata
caaaatagatttaaaacaggtttagatattgctaaatataccgctgccattatgagaaaa
gacatggcagagtacgatgcagacactacaaaatacacgcaatctttaggttgttggcat
ggttttgttgcccaacaaaaaatgatagctgttaaaaaacatcaccaaactacaaacaaa
aaatacttatacctttctggttggatggttgctgcattacgttcagagtttggcccatta
ccagaccaatctatgcatgaaaaaactgctgtacctgaattaattgcagaaatttatgat
ttcttgcgtcaagcagatgctatagaattaaacgatttatttagacgcttagaaaatggt
gaagacgtacaagacaaaatagataatttcgaaactcacattgtacctattatagcagat
attgatgctggttttggtaatgaagaagcaacctatttattatcaaaaaaaatgatacaa
gctggtgcttgtgcaatacaaattgaaaaccaagtatctgatgctaaacaatgcggtcac
caagatggcaaagttaccgtaccacatgaggattttatagcaaaactaaatgcagtaaga
tatgcttttttagaattaggtattgaagacgggattatagttgctagaacagattctgaa
ggtgcaggattaacacaaaaacttcctgtaagtcaaaaacctggagatttagcatcacaa
tatcttgcctttgttgaagcagaagaaattgatattaataatgctaaagaagatgatgtt
ttacttaaaagagatggtaaacttgttagacctgttcgtcttgccaatggcttatataaa
tttagagatggtaccaatattgaccgtgttgtattagattgtgtaactagcttacaaaat
ggagcagatttattatggatagaaacaccaactccaaacgttaaacaaatagcgcatatg
gttaatagagtgcgcgaaacaattccaaacgcaaaattggtatacaataattcaccatca
tttaactggactttaaattttagaaatcaagcatatgatgctatgcttttagaaggaaaa
aaccttacggcatatgatagaaacaatttaatggctgaagagtatgataattcagagtta
agtctgcgtgcagaccaaaatataaaaacgtttcaagcagatgcatcaagagaagccgga
atatttcaccacttaataaccttaccaacttatcacacaactgcgttgcatatgaataat
ttaactcaaggatactttggtaaagaaggcatgttaacttatgtaaaagaagtacaacgt
caagagattagaaaaggcgtatcatgcgtaaaacaccaaagaatggcaggatctgattta
ggtgatgatcataaaacattttttgcaggagaaaaagcactaaaagctagcggagaaaat
aacacatcaaaccaatttgaaaacactactaaaactactccttttataaatattgcagta
taa

DBGET integrated database retrieval system