KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0242Help
Entry
Lacal_0242        CDS       T01533                                 

Definition
succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lan01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lan00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lan00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:lan00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(275373..276566)
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKELLSSFGVRIQRGIVAQNADEAVTAAKKLTEDTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLDEVKSIANDIIGMDLVTPQTSAEGKRVHQVLVAEDVYYPGDSEPEEYYMS
VLLNRGTGRNMIMYSTEGGMDIETVAEETPHLIFTEEIDPATGILPFQARKVAFNLGLSG
AAFKDMTKFVTSLYTAYVKSDSSLFEINPVLKTSDDKIMAVDAKVTLDANALYRHKDLAE
LRDIREESPIEVEAGELGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TADAKRVEAAFRIILKDPAVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAINVPIIVRL
QGTNADIAKELIDSSGLDVMSATEFQEAADKVQTVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaaggaaaagaattattaagcagctttggcgtacgtatccaa
cgcggtatagttgcacaaaacgctgatgaagctgtaactgcagctaaaaagctaacagaa
gataccggaacaggatggcacgtaattaaagctcaagttcacgccggtggtcgtggaaaa
ggtggtggcgtaaagcttgctaaaaacttagacgaagtaaaatctatcgctaatgatatt
attggtatggatttagtgacacctcaaacttctgcagaaggtaagcgtgtacaccaagtt
ttagtagcagaagatgtttactatccaggagattctgagccagaagaatattacatgtct
gtacttttaaatagaggaactggacgtaatatgattatgtattctacagaaggtggaatg
gatattgaaactgtagcagaagaaacgccacatttaatttttactgaagaaatagatcct
gcaactggaattttaccatttcaagcacgtaaagttgcttttaacttaggtttatctgga
gcagcatttaaagacatgacaaaatttgtaacgtctttatatacagcttacgtaaaatct
gattcttctttatttgaaatcaatcctgttttaaaaacaagtgacgataaaataatggca
gtagatgctaaagtaactttagacgctaatgcattatacagacataaagatttagccgag
ttacgtgacatacgtgaagaaagcccaattgaagttgaagctggtgaattaggacttaac
tatgtagatcttgacggtaacgttgggtgtatggtaaatggtgctggtttagcaatggca
acaatggatttaattaaacaagctggtggagaacctgcaaactttttagacgttggtggt
actgcagatgctaaacgtgttgaagcagcttttagaattatattaaaagatccagctgta
aaagcaattttaataaacatttttggtggtattgtacgttgtgatcgtgtagcacaagga
gttgtagatgcatacaagaatatgggtgacgctataaacgttccaattattgtacgttta
caaggtactaatgcagatatcgcaaaagaactaattgatagttctggattagatgtaatg
agtgctacagaatttcaagaagcagcagataaagtacaaactgttttagcataa

DBGET integrated database retrieval system