KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0242Help
Entry
Lacal_0242        CDS       T01533                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00020  Citrate cycle (TCA cycle)
lan00640  Propanoate metabolism
lan00660  C5-Branched dibasic acid metabolism
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01120  Microbial metabolism in diverse environments
lan01130  Biosynthesis of antibiotics
lan01200  Carbon metabolism
Module
lan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lacal_0242
   00640 Propanoate metabolism
    Lacal_0242
   00660 C5-Branched dibasic acid metabolism
    Lacal_0242
Enzymes [BR:lan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lacal_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEH00095
UniProt: F6GIP7
Position
complement(275373..276566)
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKELLSSFGVRIQRGIVAQNADEAVTAAKKLTEDTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLDEVKSIANDIIGMDLVTPQTSAEGKRVHQVLVAEDVYYPGDSEPEEYYMS
VLLNRGTGRNMIMYSTEGGMDIETVAEETPHLIFTEEIDPATGILPFQARKVAFNLGLSG
AAFKDMTKFVTSLYTAYVKSDSSLFEINPVLKTSDDKIMAVDAKVTLDANALYRHKDLAE
LRDIREESPIEVEAGELGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TADAKRVEAAFRIILKDPAVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAINVPIIVRL
QGTNADIAKELIDSSGLDVMSATEFQEAADKVQTVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaaggaaaagaattattaagcagctttggcgtacgtatccaa
cgcggtatagttgcacaaaacgctgatgaagctgtaactgcagctaaaaagctaacagaa
gataccggaacaggatggcacgtaattaaagctcaagttcacgccggtggtcgtggaaaa
ggtggtggcgtaaagcttgctaaaaacttagacgaagtaaaatctatcgctaatgatatt
attggtatggatttagtgacacctcaaacttctgcagaaggtaagcgtgtacaccaagtt
ttagtagcagaagatgtttactatccaggagattctgagccagaagaatattacatgtct
gtacttttaaatagaggaactggacgtaatatgattatgtattctacagaaggtggaatg
gatattgaaactgtagcagaagaaacgccacatttaatttttactgaagaaatagatcct
gcaactggaattttaccatttcaagcacgtaaagttgcttttaacttaggtttatctgga
gcagcatttaaagacatgacaaaatttgtaacgtctttatatacagcttacgtaaaatct
gattcttctttatttgaaatcaatcctgttttaaaaacaagtgacgataaaataatggca
gtagatgctaaagtaactttagacgctaatgcattatacagacataaagatttagccgag
ttacgtgacatacgtgaagaaagcccaattgaagttgaagctggtgaattaggacttaac
tatgtagatcttgacggtaacgttgggtgtatggtaaatggtgctggtttagcaatggca
acaatggatttaattaaacaagctggtggagaacctgcaaactttttagacgttggtggt
actgcagatgctaaacgtgttgaagcagcttttagaattatattaaaagatccagctgta
aaagcaattttaataaacatttttggtggtattgtacgttgtgatcgtgtagcacaagga
gttgtagatgcatacaagaatatgggtgacgctataaacgttccaattattgtacgttta
caaggtactaatgcagatatcgcaaaagaactaattgatagttctggattagatgtaatg
agtgctacagaatttcaagaagcagcagataaagtacaaactgttttagcataa

DBGET integrated database retrieval system