KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0332Help
Entry
Lacal_0332        CDS       T01533                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00010  Glycolysis / Gluconeogenesis
lan00051  Fructose and mannose metabolism
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01120  Microbial metabolism in diverse environments
lan01130  Biosynthesis of antibiotics
lan01200  Carbon metabolism
lan01230  Biosynthesis of amino acids
Module
lan_M00002  Glycolysis, core module involving three-carbon compounds
lan_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lacal_0332
   00051 Fructose and mannose metabolism
    Lacal_0332
   00562 Inositol phosphate metabolism
    Lacal_0332
Enzymes [BR:lan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lacal_0332
Exosome [BR:lan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lacal_0332
  Exosomal proteins of bladder cancer cells
   Lacal_0332
  Exosomal proteins of melanoma cells
   Lacal_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEH00184
UniProt: F6GJS5
Position
complement(368582..369331)
Genome map
AA seq 249 aa AA seqDB search
MRKNIVAGNWKMNNDLPQTEALIVDLLKQTQTSNAEVMIAPTYVNLYQAFDATRNSNIEV
IAQNMHFAENGAYTGEISATMLKSVGVKTVILGHSERRAYFNETNESLAKKVDAALKNDL
RIIFCFGEELSDRKSGNQEQVVENQIKSALFHLEASAFKNIVLAYEPVWAIGTGETASPE
QAQDMHKFIRQTLQNKYGENTAQDVSILYGGSVKPANAKEIFSKPDVDGGLIGGASLKAE
DFIAIVNAF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatatagtagcaggaaactggaaaatgaataacgatttacctcaaaccgaa
gcattaatcgtagacctattaaaacaaacacaaacctcaaatgccgaggtcatgattgca
ccaacctacgtaaacctttatcaagcattcgatgctacaagaaactctaatatagaagta
atagcacaaaacatgcactttgcagaaaacggcgcatatacaggagaaattagcgcaaca
atgctaaaaagtgtaggagtaaaaacagtaatattaggccacagcgagcgtcgcgcatac
tttaacgaaaccaatgagtctttagcaaaaaaagtagatgccgcattaaaaaacgattta
cgaataattttttgttttggagaagaattaagcgatcgtaaatcaggaaaccaagaacaa
gtagtagaaaaccaaataaaaagcgcattgtttcacctagaagcatcagcatttaaaaac
atagttttagcctacgagccagtatgggcaataggtacaggagaaacagcaagtccagaa
caagcgcaagacatgcataaatttatacgccaaacattacaaaataaatatggcgaaaat
accgcacaagacgtatcaatactctacggcggaagcgtaaaaccagcaaacgcaaaagaa
atattctcaaaaccagacgtcgatggcggcttaattggaggcgcatcactaaaagccgaa
gattttatagccatagtaaacgcattttaa

DBGET integrated database retrieval system