KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0332Help
Entry
Lacal_0332        CDS       T01533                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lacal_0332
   01230 Biosynthesis of amino acids
    Lacal_0332
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lacal_0332
   00051 Fructose and mannose metabolism
    Lacal_0332
   00562 Inositol phosphate metabolism
    Lacal_0332
Enzymes [BR:lan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lacal_0332
Exosome [BR:lan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lacal_0332
  Exosomal proteins of bladder cancer cells
   Lacal_0332
  Exosomal proteins of melanoma cells
   Lacal_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(368582..369331)
Genome map
AA seq 249 aa AA seqDB search
MRKNIVAGNWKMNNDLPQTEALIVDLLKQTQTSNAEVMIAPTYVNLYQAFDATRNSNIEV
IAQNMHFAENGAYTGEISATMLKSVGVKTVILGHSERRAYFNETNESLAKKVDAALKNDL
RIIFCFGEELSDRKSGNQEQVVENQIKSALFHLEASAFKNIVLAYEPVWAIGTGETASPE
QAQDMHKFIRQTLQNKYGENTAQDVSILYGGSVKPANAKEIFSKPDVDGGLIGGASLKAE
DFIAIVNAF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaatatagtagcaggaaactggaaaatgaataacgatttacctcaaaccgaa
gcattaatcgtagacctattaaaacaaacacaaacctcaaatgccgaggtcatgattgca
ccaacctacgtaaacctttatcaagcattcgatgctacaagaaactctaatatagaagta
atagcacaaaacatgcactttgcagaaaacggcgcatatacaggagaaattagcgcaaca
atgctaaaaagtgtaggagtaaaaacagtaatattaggccacagcgagcgtcgcgcatac
tttaacgaaaccaatgagtctttagcaaaaaaagtagatgccgcattaaaaaacgattta
cgaataattttttgttttggagaagaattaagcgatcgtaaatcaggaaaccaagaacaa
gtagtagaaaaccaaataaaaagcgcattgtttcacctagaagcatcagcatttaaaaac
atagttttagcctacgagccagtatgggcaataggtacaggagaaacagcaagtccagaa
caagcgcaagacatgcataaatttatacgccaaacattacaaaataaatatggcgaaaat
accgcacaagacgtatcaatactctacggcggaagcgtaaaaccagcaaacgcaaaagaa
atattctcaaaaccagacgtcgatggcggcttaattggaggcgcatcactaaaagccgaa
gattttatagccatagtaaacgcattttaa

DBGET integrated database retrieval system