KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0350Help
Entry
Lacal_0350        CDS       T01533                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lan00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393715..394392
Genome map
AA seq 225 aa AA seqDB search
MKVENTTNDYDELGENHVGTSSDTPMKSDAFKLTDKEKIDRIQNDVRNIMETLGLDLTDD
SLSGTPKRVAKMFVNEIFGGLNPDKKPNASTFDNKYKYGEMLVEKNITLYSTCEHHLLPI
VGKAHIAYISNGNVVGLSKMNRIVDYFAKRPQVQERLTIQVVKELQKVLNTEDVACVIDA
KHLCVNSRGIRDIESSTVTSEFGGQFKNKETKREFLDYISLETKF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgaaaacacaacaaatgactatgacgaattaggagaaaaccacgttggcact
tcttctgatactcccatgaaatctgacgcttttaagctaacagacaaagagaaaatagac
cgtattcaaaatgatgttcgtaacatcatggaaacactaggtttagatttaacagacgat
agtttgagtggtacaccaaaacgtgttgcaaaaatgtttgtaaacgaaatatttggtggt
ttaaatccagacaaaaaaccaaatgcttctacttttgataacaagtataagtatggtgaa
atgctggtagaaaaaaacattacactttactctacctgcgaacaccacctattaccaata
gttggtaaagcacatatagcttacatttctaatggtaatgtcgttggtttatctaaaatg
aatcgtattgtagactattttgcaaaacgcccacaagtacaagaacgtttaacaatacaa
gttgtaaaagaacttcaaaaagttttaaacacagaagatgttgcctgtgtaatagatgct
aaacacctatgcgtaaattcaagaggtattcgtgatattgaaagtagcacggtaacttca
gaatttggtggtcaatttaaaaacaaagaaaccaaacgtgagtttttagattacattagc
ttagagactaaattttaa

DBGET integrated database retrieval system