KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0538Help
Entry
Lacal_0538        CDS       T01533                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lacal_0538
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lacal_0538
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Lacal_0538
Enzymes [BR:lan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lacal_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591161..591952
Genome map
AA seq 263 aa AA seqDB search
MDDSIKDDSIKRVVVKVGTNVLTNKDNRILGPVLRELVRQISVLDERNIQVVLVTSGSAI
AGKEVLGNIQETEASVRRQIYSSVGQPRLMRHYYSLFHDYGMRCAQILATKRDFDPGKHR
ENMISCYEGLLAEGVTPIANEDDAVSLSMSMFSDNDELASLVAELIDADRLIILSDTDGL
YTGHPEDKNSRKLTEVTVDQNVEKYVQSNSKKEGEGRGGMASKLKIAKVTAKKNIPTYIA
SGKRENVIVDIINNKQVGTKFIH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggacgacagtattaaagacgatagtataaaaagagtagtagttaaagttggtacaaac
gtattaacaaataaagacaaccgtattttaggtccggtacttcgagaattggtaaggcaa
atctctgtgctagacgaaagaaatatacaagttgtacttgtaacttcaggttctgctatt
gccggtaaagaagttttaggaaatattcaagaaaccgaagcatctgttagacgtcaaata
tattcctcggttggacaaccacgattaatgagacactattatagtttatttcatgattac
ggtatgcgttgcgcacaaattttagcaacaaaaagagatttcgatccaggaaaacataga
gaaaacatgattagttgttatgaaggtttattagccgaaggcgttacacctatagcaaac
gaagatgatgcagtatcattaagtatgtctatgttttcagacaatgatgagctagcaagt
ttagtagcagagttaatagatgcagaccgcttaattattttatcagacacagatggtctt
tacacaggacacccagaagataaaaactctagaaaacttacagaagtcacagtagaccaa
aatgtagaaaaatatgtgcaatccaactctaaaaaagaaggagaaggtcgtggcggcatg
gcttcaaaattaaaaatcgcaaaagtaaccgctaaaaaaaacattcctacctacatagca
tcaggaaaaagagaaaatgtaattgttgatattattaacaataagcaagtaggaacaaaa
tttattcactaa

DBGET integrated database retrieval system