KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0538Help
Entry
Lacal_0538        CDS       T01533                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lan01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lan00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
591161..591952
Genome map
AA seq 263 aa AA seqDB search
MDDSIKDDSIKRVVVKVGTNVLTNKDNRILGPVLRELVRQISVLDERNIQVVLVTSGSAI
AGKEVLGNIQETEASVRRQIYSSVGQPRLMRHYYSLFHDYGMRCAQILATKRDFDPGKHR
ENMISCYEGLLAEGVTPIANEDDAVSLSMSMFSDNDELASLVAELIDADRLIILSDTDGL
YTGHPEDKNSRKLTEVTVDQNVEKYVQSNSKKEGEGRGGMASKLKIAKVTAKKNIPTYIA
SGKRENVIVDIINNKQVGTKFIH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggacgacagtattaaagacgatagtataaaaagagtagtagttaaagttggtacaaac
gtattaacaaataaagacaaccgtattttaggtccggtacttcgagaattggtaaggcaa
atctctgtgctagacgaaagaaatatacaagttgtacttgtaacttcaggttctgctatt
gccggtaaagaagttttaggaaatattcaagaaaccgaagcatctgttagacgtcaaata
tattcctcggttggacaaccacgattaatgagacactattatagtttatttcatgattac
ggtatgcgttgcgcacaaattttagcaacaaaaagagatttcgatccaggaaaacataga
gaaaacatgattagttgttatgaaggtttattagccgaaggcgttacacctatagcaaac
gaagatgatgcagtatcattaagtatgtctatgttttcagacaatgatgagctagcaagt
ttagtagcagagttaatagatgcagaccgcttaattattttatcagacacagatggtctt
tacacaggacacccagaagataaaaactctagaaaacttacagaagtcacagtagaccaa
aatgtagaaaaatatgtgcaatccaactctaaaaaagaaggagaaggtcgtggcggcatg
gcttcaaaattaaaaatcgcaaaagtaaccgctaaaaaaaacattcctacctacatagca
tcaggaaaaagagaaaatgtaattgttgatattattaacaataagcaagtaggaacaaaa
tttattcactaa

DBGET integrated database retrieval system