KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0653Help
Entry
Lacal_0653        CDS       T01533                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lacal_0653
Enzymes [BR:lan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Lacal_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(725485..726423)
Genome map
AA seq 312 aa AA seqDB search
MQTKTYAGIGEEFSKLETSKIVLIPVPYDGTSTWQKGADKGPDAFLNASENMELYDIETE
TEVYKQGIYLADAVTENTSPEAMVDAVHKATKKYIKKNKFVTIFGGEHSISIGTIRAFNE
MYPSLTVLQLDAHADLRKEYEGSKCNHACAVYEASQTTNLIQVGIRSMDVIETTVMDKEK
TYFAHEMAIDDTWMDSAVDQMTENVFITIDLDAFDPSIMPSTGTPEPGGLLWYETLEFLK
QVFAEKNVVGFDIVELCPNKIDKSSDFLAAKLYYKMLSYKFENDDAEADYDNAYENVKQK
NNSAKYNEDDEY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactaaaacttatgcaggtattggagaagaattctctaaacttgaaacatcaaaa
attgtattaatacctgtgccttacgatggtacaagtacttggcaaaaaggcgcagataaa
ggtccagatgcatttttaaatgcttcagaaaatatggagctatacgacattgaaacagaa
accgaagtttacaaacaaggtatttatctggcagatgctgtaacagaaaatacttcgcca
gaagcaatggtagatgctgtgcataaagcaactaaaaagtacattaaaaaaaataagttt
gttaccatatttggaggagaacactctatttctataggtactattcgtgcttttaatgaa
atgtacccaagcttaacagttttacagcttgatgcgcatgcagatttgcgtaaggagtac
gaaggctcaaaatgtaaccatgcctgtgcagtttacgaggctagccaaacaactaaccta
attcaagtaggtattcgttctatggatgttatagaaacgactgtaatggacaaagagaaa
acatattttgcacatgaaatggctatagatgatacttggatggatagtgcagtagatcaa
atgaccgagaatgtatttatcactatagatttagatgcattcgatccttcaataatgcca
agtacaggaacaccagaacctggcggtttattatggtatgaaacattagaatttttaaag
caagtattcgcagagaaaaatgtagtaggttttgatattgtcgagttatgcccaaataaa
attgataaatcttcagattttttagccgcaaaattatactacaaaatgctaagctataaa
tttgaaaatgatgatgccgaagcagattacgacaatgcttacgagaatgtaaaacaaaaa
aataacagtgctaaatacaacgaagacgatgaatactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system