KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0867Help
Entry
Lacal_0867        CDS       T01533                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lan00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001108..1001695
Genome map
AA seq 195 aa AA seqDB search
MKQGKLIVFSAPSGSGKTTIVRHLLKQKELNLAFSISATSREKRGTEVHAEDYYFMSAKE
FKQHIKEDNFLEWEEVYRDNFYGTLKTEVERLWALGKNVIFDIDVSGGLRIKRKFPEQTL
AVFVKPPSIDELKIRLKNRKTESDEKISMRVAKASAELATAPLFDTIIENDNLEKALHEA
EAVVGHFLISEIKKE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggtaaactaattgtattttcagcaccatctggctctggtaaaacaaccatt
gttaggcatttattaaaacaaaaagaattaaatctagccttttcaatctctgcaacatca
cgcgaaaaaagaggtacagaagttcatgcagaagattactattttatgtctgcaaaagaa
tttaaacaacacataaaagaagacaattttttagagtgggaagaagtttatagagataat
ttttatggcactttaaaaaccgaagtagaacgtctttgggcgttaggaaaaaatgtaatt
ttcgatatagatgtttctggaggtttgcgtataaaacgaaaattcccagaacaaacctta
gctgtttttgtaaaaccaccaagcatagacgaacttaaaataaggttaaaaaacagaaaa
acagaaagtgatgagaaaataagtatgcgcgtagcaaaagcaagtgcagaattagctaca
gcaccactttttgatacaattatagaaaatgataatttagaaaaagcactacatgaagct
gaagctgtagttggtcattttttaatttcagaaataaaaaaagaataa

DBGET integrated database retrieval system