KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0867Help
Entry
Lacal_0867        CDS       T01533                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00230  Purine metabolism
lan01100  Metabolic pathways
Module
lan_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Lacal_0867
Enzymes [BR:lan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Lacal_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 cobW RsgA_GTPase TsaE ABC_tran AAA AAA_19 AAA_24 T2SSE CPT AAA_30
Motif
Other DBs
NCBI-ProteinID: AEH00715
UniProt: F6GF78
Position
1001108..1001695
Genome map
AA seq 195 aa AA seqDB search
MKQGKLIVFSAPSGSGKTTIVRHLLKQKELNLAFSISATSREKRGTEVHAEDYYFMSAKE
FKQHIKEDNFLEWEEVYRDNFYGTLKTEVERLWALGKNVIFDIDVSGGLRIKRKFPEQTL
AVFVKPPSIDELKIRLKNRKTESDEKISMRVAKASAELATAPLFDTIIENDNLEKALHEA
EAVVGHFLISEIKKE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggtaaactaattgtattttcagcaccatctggctctggtaaaacaaccatt
gttaggcatttattaaaacaaaaagaattaaatctagccttttcaatctctgcaacatca
cgcgaaaaaagaggtacagaagttcatgcagaagattactattttatgtctgcaaaagaa
tttaaacaacacataaaagaagacaattttttagagtgggaagaagtttatagagataat
ttttatggcactttaaaaaccgaagtagaacgtctttgggcgttaggaaaaaatgtaatt
ttcgatatagatgtttctggaggtttgcgtataaaacgaaaattcccagaacaaacctta
gctgtttttgtaaaaccaccaagcatagacgaacttaaaataaggttaaaaaacagaaaa
acagaaagtgatgagaaaataagtatgcgcgtagcaaaagcaagtgcagaattagctaca
gcaccactttttgatacaattatagaaaatgataatttagaaaaagcactacatgaagct
gaagctgtagttggtcattttttaatttcagaaataaaaaaagaataa

DBGET integrated database retrieval system