KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0869Help
Entry
Lacal_0869        CDS       T01533                                 

Definition
signal transduction histidine kinase with CheB and CheR activity (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lan00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lacal_0869
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Lacal_0869
Enzymes [BR:lan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Lacal_0869
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Lacal_0869
Two-component system [BR:lan02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Lacal_0869
Bacterial motility proteins [BR:lan02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Lacal_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002404..1006837
Genome map
AA seq 1477 aa AA seqDB search
MKNKSPKFHVVGIGASAGGLDAIQTLFDHIPPNTGMAFIIIQHLSPDFKSLMPELLSKHT
EMPIYTAEDKLKIKPNCVYLNQRSKNLHIKGSQLYLLDKGPKNNLNLPIDIFFHTLGEEF
KEKSIGVILSGTGSDGSRGIKTIKEGRGTIIVQDPTSAQFDGMPNSAISTNIVDYILNPK
KIAEIIHKNPTSRSLALNDFEKNPSNESLINDILTVVYKHSGIDFREYKKNTLLRRIEKR
MNIKNIQHLYDYTTFVSSNIEEQQALQEDFLIGVTRFFRDSEAFKNLKEKVIPELCKNKD
NSEIIRVWIAGCSTGEEVYTLAILIDNYIRSHQLNLDFKIFATDIDPTALNIAGKGMYHV
NIINEIDKIYLDQYFIKTGNKIQIIKRIREKIVFSYHNLIKDPPFIRMDLISCRNLLIYF
DSKIQKKVMMNFQFALNKYSYLFLGNSESLGEVSKYFKTIDVKWKIFQNISSTKQIPSQN
SSIDKISAIAYKYPERKNTYSSLNIKESPELIFHKYLSQKFSPASIFIDKDFNILFINGD
AGKRLSHNSGIFQNNLLQMVSPDISVVIRSGIRRLEAQKQDVIIKGIQNKTEKENFSFDL
KFHEPKNFDNLQDCYLIEFSNDKVINYNQPLIVNNIDIDEASVQRLEDLESDLKIAKTEL
QNVVEELETSNEELQSSNEELMASNEELQSTNEELQSVNEELYTVNTEMQEKNKELTNLN
NDITNLLDNTDIATLFLDTDLRIRKFTPALQDVFNLQEIDHGRPLSSFTSNFEEQTRNLI
IKDSKNVLDKLTVIEKQVKDKDDNFYLLRISPFITSDKVINGVVITLDNINKLKEIENEL
ADTDLKYHKLFENLNEAFIHAKIVKDKNGNPTDWEYIDVNPAYEKLFNLKAKAIIGKKAS
TVLPVIKNELTNWIKKYGETAMTGIDQTIEGYIKSLDKYFLVNVFSPKNGEFAGTITDFT
ELKSKEQALKKSEAELNRIQELTVVGGWYLDLKTDKVYWTEQLFKMYGLDPNSTPPDYSK
QRKLFTKQSWLNLNKAVEKTQKYGIPYVIELNLIKEDGEKGWLRAQGEAVKDEKGNIIAL
RGAAQDITKQKLIEEEIINAKKAAESANLHKNYFLANMSHEIRTPMNGVLGFSELLKKDS
LSKTDRLKYLEIIDSNSKQLLNLIDDIIDIAKIESNELKINYTECNVPKLIQNLQITYNQ
LKIVKLKKNITFTTYIPENYKDLQIITDEQRLQQVISNLLNNSLKFSEKGNISFGFTVIG
KFLKFFVKDQGIGINKNKQLEIFERFKQLNYKSNAKYGGTGLGLSISKGIVTLLGGDITV
TSQENKGSMFEFTIPLKEANTKHKSIEKNQKLKNKFLLNKNILIAEDDSLIRLLFKIVLK
DTGVNVLFAKNGKEAVELYKSTPNIDVVLLDIRMPEMSGIEAMEIILKLNPEAKIIMQTA
YAMQDEKEKCYHKGCVDFLSKPIVKEELFTKLSKWIN
NT seq 4434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaaagccctaagtttcatgtcgttggtattggagcgtctgctggtggttta
gatgctattcaaacattgtttgaccacataccgcctaatacaggaatggcatttataatt
atacagcacctttctccagattttaaaagcctaatgccagagctactaagtaagcataca
gaaatgcctatttatacagcagaagacaaactaaaaataaaaccaaattgcgtttattta
aaccaacgtagcaaaaacctacacataaaagggtctcaattatacctattagacaaaggc
ccaaaaaataatctaaacttaccaatagacattttttttcatacgcttggagaagaattt
aaagaaaaatctattggtgtaatattatctggaacaggatctgatggatccagaggtata
aaaacaataaaagaaggtcgaggcacaattattgttcaagacccaacatctgcccaattt
gatggaatgccaaactctgcaatttcaacaaatattgtagactacattttgaacccaaaa
aaaatagcagaaatcatacataaaaatccaacaagcaggtctctagctcttaatgatttt
gaaaaaaatccatctaacgaatccttgataaatgacatattaactgttgtttataaacac
tctggcatagattttagagaatataaaaaaaatacacttttaagacgtatagaaaaaaga
atgaatataaaaaatattcaacacctatacgattacactacatttgtttcaagtaatata
gaagagcagcaagctctacaagaagattttttaataggtgttacacgcttttttagagac
agtgaagccttcaaaaatttaaaagaaaaagtaattccagagttatgtaaaaataaagac
aactctgaaattataagggtttggatagcaggttgctctacaggagaagaagtctataca
ttagcaatattaatagacaattatataagatctcaccaactaaatcttgattttaaaata
tttgcaacagatatagatcctacagcattaaacattgctggtaaaggcatgtatcatgta
aatattataaatgaaattgataaaatatacttagaccaatattttataaaaacaggaaat
aaaatacaaattattaaacgtattagagaaaaaatagtgttctcttaccataatttaatt
aaagaccctccatttataagaatggatcttatttcttgtagaaatctacttatttatttt
gatagtaagatacagaaaaaagtaatgatgaattttcagtttgccttaaataaatattct
tatttatttttaggtaatagcgaatctttaggcgaagtttcaaagtattttaaaacaata
gatgtaaaatggaaaatttttcaaaatatatcctctacaaaacaaataccatcacaaaat
tcaagtatagataaaatatcggcaatagcatacaagtaccctgaacgcaaaaacacatac
agctctttaaatataaaggaaagtccagagttaatttttcataaatatttaagtcaaaaa
tttagtcctgcctctatttttattgataaagatttcaatattctatttattaatggtgat
gcaggaaaacgcttatctcacaattcaggaatttttcaaaacaacttattgcaaatggta
agcccagacatttctgtagttataagaagtggaataagaagacttgaagcacaaaagcaa
gatgttattattaaaggcattcaaaacaaaacagaaaaagaaaatttctctttcgattta
aaatttcacgaacccaaaaattttgataatttacaagactgttatttaatagaatttagt
aacgataaggttataaattataaccaaccattaattgttaataacattgatattgatgag
gcatccgtacaacgccttgaggatttagaaagcgatcttaaaatagcaaaaaccgaatta
caaaatgtagtcgaggaattagaaaccagtaacgaggagttacaatcttctaacgaagaa
ctaatggcttctaatgaagaacttcaaagtacaaacgaagagctacaatctgtaaacgaa
gaactgtataccgtaaatacagaaatgcaggaaaaaaataaagagctcacaaacttaaat
aacgacattacaaacctgctagacaacacagatatagcaacattatttttagatacagat
ttaagaataagaaagtttacaccagcgcttcaagatgtatttaatttacaagaaatagat
catggtagacctttatctagttttacatctaactttgaagagcaaacaagaaacctaata
attaaagactctaaaaacgtattagataaattaacggttattgaaaaacaagtaaaagac
aaggacgataacttttatttactacgtataagcccatttattacttcagataaggttata
aacggagtagttattacactcgataacattaataagcttaaagaaattgaaaatgaatta
gcagatacagatttaaaatatcacaaattattcgaaaatttaaacgaagcttttattcat
gctaaaattgttaaagacaaaaacggcaatcctacagattgggaatatatagatgttaat
cctgcttacgaaaaattatttaatttaaaagctaaagctataattggtaaaaaagcatct
accgttttaccagttataaaaaatgagttaacaaattggattaaaaaatatggcgaaact
gccatgacaggcatagaccaaactatagaaggctacataaaatctttagataaatacttt
ttagtaaacgtattctcacctaaaaatggtgaatttgcaggaacaataacagattttact
gagcttaaaagtaaagagcaagctcttaaaaaaagtgaagcagagttaaatagaattcaa
gaactcacagttgttggcggctggtatttagaccttaaaacagataaagtatactggaca
gagcaactttttaaaatgtatggactagaccctaactctacgcctccagactattcaaaa
caacgaaaattgtttacaaaacaaagctggctaaaccttaataaagctgtagagaaaacc
caaaaatacggcataccttacgttatagaattaaaccttataaaagaagatggcgaaaaa
ggatggcttagagcacaaggagaagctgtaaaggacgaaaaaggaaacattatagcttta
agaggtgctgctcaagatattacaaaacaaaaattaattgaagaagaaataataaatgca
aaaaaagcagcagaatctgcaaacctgcacaaaaactatttcttagcaaatatgagtcat
gaaattagaacaccaatgaatggtgtcttaggcttttcagaattattaaaaaaagatagt
ctatctaaaaccgatagattaaaatatcttgaaattatagatagtaactccaaacagcta
ttaaatttaattgacgacattattgatattgccaaaattgagtcaaacgaattaaaaata
aattatacagaatgtaatgtaccaaagcttattcaaaacttacaaattacctacaaccaa
ttaaaaattgtaaaacttaaaaagaacataacatttacaacttacatcccagaaaactat
aaagacttacaaataattacagatgagcaaagactgcaacaagtcatatctaacctttta
aacaattcattaaaattttctgaaaaaggtaatatctcatttggctttacagtaattgga
aaatttctaaagttctttgtaaaagatcaaggtataggaattaacaaaaacaagcaactt
gaaatatttgaaagatttaaacagctaaactataaaagtaacgcaaaatatggcggtaca
ggattagggctttctataagtaaaggaattgtaacactattaggtggtgatattacagtt
acatctcaagaaaataaaggttctatgtttgagtttacaatacctttaaaagaagcaaat
acaaaacataaaagtatagaaaaaaaccaaaagcttaaaaacaagtttttgctaaataaa
aatatactaattgcagaagacgactctttaattagacttttatttaaaattgtacttaaa
gatacaggtgtaaatgtgctatttgcaaaaaatggaaaagaagctgtagagctatataaa
agtacgcctaatatagatgttgtgcttttagacattagaatgccagaaatgagtggtatt
gaagccatggaaataatattaaaattaaatcctgaggctaaaattattatgcaaacagct
tatgctatgcaagatgaaaaagaaaaatgctaccataaaggttgtgtagatttcctatct
aaacctattgtaaaagaagaattgtttacaaagctaagtaaatggattaattaa

DBGET integrated database retrieval system