KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0939Help
Entry
Lacal_0939        CDS       T01533                                 

Definition
metallophosphoesterase
Orthology
K03269  
UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:lan00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1091673..1092425)
Genome map
AA seq 250 aa AA seqDB search
MQIPKGKKIYFASDNHLGAPTQKHSFPREKKFVAWLDEIKEDAAAIFLLGDLFDFWAEYK
TVVPKGFTRTLGKLAEISDSGIPVYYFVGNHDLWMNGYFEEELNIPVYHKPQEFTFNNKT
FLIGHGDGLGPGDKGYKRMKKVFTNPVAKWFFRWLHPDLGVRLAQYLSVKNKLISGDDDA
KFLGENEEWLVQYCKRKLEDKHRDYFVFGHRHLPLNIDLNGNSKYINLGDWIKYYTYGVF
NGETLELKEY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattccaaaaggaaagaaaatatactttgcttcagataatcatttaggagcacca
acccaaaaacactcttttccaagagaaaaaaagtttgttgcctggctagatgagattaaa
gaagatgctgctgcaatatttttgttgggtgatttattcgacttttgggcagaatataaa
actgttgttcctaagggatttactcgaacattaggaaaattagcagaaattagcgattct
ggtattccggtttattactttgtaggtaatcatgatttatggatgaatggctattttgaa
gaagaacttaacataccggtttaccataaacctcaagaatttacttttaataataaaaca
tttttaattggtcatggcgatggtttaggcccaggagataaaggttataagcgcatgaaa
aaagtatttactaatccagttgcaaaatggttttttagatggttacatccagatttaggt
gtgcgattggcacaatacctatcagtaaaaaataaattaatttcgggagacgatgacgcc
aagtttttgggggaaaatgaggagtggctagtgcagtactgcaaacgaaaacttgaagat
aaacatcgcgattattttgtttttgggcatagacatttgcctttaaacatagatttaaat
ggtaattctaaatatattaatctaggagattggattaaatattatacttacggtgttttt
aatggtgaaacattagagcttaaagagtattaa

DBGET integrated database retrieval system