KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0939Help
Entry
Lacal_0939        CDS       T01533                                 

Definition
metallophosphoesterase
Orthology
K03269  
UDP-2,3-diacylglucosamine hydrolase [EC:3.6.1.54]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Lacal_0939
Enzymes [BR:lan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.54  UDP-2,3-diacylglucosamine diphosphatase
     Lacal_0939
Lipopolysaccharide biosynthesis proteins [BR:lan01005]
 Lipid A
  Lacal_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1091673..1092425)
Genome map
AA seq 250 aa AA seqDB search
MQIPKGKKIYFASDNHLGAPTQKHSFPREKKFVAWLDEIKEDAAAIFLLGDLFDFWAEYK
TVVPKGFTRTLGKLAEISDSGIPVYYFVGNHDLWMNGYFEEELNIPVYHKPQEFTFNNKT
FLIGHGDGLGPGDKGYKRMKKVFTNPVAKWFFRWLHPDLGVRLAQYLSVKNKLISGDDDA
KFLGENEEWLVQYCKRKLEDKHRDYFVFGHRHLPLNIDLNGNSKYINLGDWIKYYTYGVF
NGETLELKEY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattccaaaaggaaagaaaatatactttgcttcagataatcatttaggagcacca
acccaaaaacactcttttccaagagaaaaaaagtttgttgcctggctagatgagattaaa
gaagatgctgctgcaatatttttgttgggtgatttattcgacttttgggcagaatataaa
actgttgttcctaagggatttactcgaacattaggaaaattagcagaaattagcgattct
ggtattccggtttattactttgtaggtaatcatgatttatggatgaatggctattttgaa
gaagaacttaacataccggtttaccataaacctcaagaatttacttttaataataaaaca
tttttaattggtcatggcgatggtttaggcccaggagataaaggttataagcgcatgaaa
aaagtatttactaatccagttgcaaaatggttttttagatggttacatccagatttaggt
gtgcgattggcacaatacctatcagtaaaaaataaattaatttcgggagacgatgacgcc
aagtttttgggggaaaatgaggagtggctagtgcagtactgcaaacgaaaacttgaagat
aaacatcgcgattattttgtttttgggcatagacatttgcctttaaacatagatttaaat
ggtaattctaaatatattaatctaggagattggattaaatattatacttacggtgttttt
aatggtgaaacattagagcttaaagagtattaa

DBGET integrated database retrieval system