KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1278Help
Entry
Lacal_1278        CDS       T01533                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lan00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1461953..1462699)
Genome map
AA seq 248 aa AA seqDB search
MKVKTILVSQPEPKIENSPYFDLSEKQKVKIDFRPFIHVEGVPSKEIRQQKIDLSKFSAI
ILTSRNAVDHFFRVAEEMRFKVPDAMKYFCQSEAVAYYLQKYVVYRKRKIYVGKRTFTEL
SPLIKKYKDENFLLPAADKLKPEVPEVLNGLGVKWKEAVFYKTVISDLSDLENVTYDILV
FFSPSGIESLFHNFPDFKQNDTRIAVFGNTTIKAVEAKGLRVDIAAPTPETPSMTMALKK
YIAAANKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaacaattttagtctcgcaaccagaacctaaaatagaaaattcgccgtat
ttcgatctatctgaaaaacagaaagttaaaatcgacttcagaccatttattcacgttgaa
ggcgttccttcaaaagaaataagacaacaaaaaattgatttaagtaagttctctgctatt
attttaacaagtagaaatgctgttgatcatttttttcgagttgctgaagaaatgcgattt
aaagtgccagacgctatgaaatatttttgccagtctgaagctgttgcctattatctgcaa
aaatatgtagtctatagaaagcgtaaaatttatgttggtaaaagaacctttacagaactt
tctcctttaattaaaaaatataaagatgaaaacttcttgcttccggctgccgataaactg
aagcctgaagtaccagaagtattaaatggtttaggcgtaaaatggaaagaagctgtgttt
tacaaaacagtaattagtgatttatctgatttagaaaatgtaacttatgatattttagta
ttctttagcccaagtggtatagaatctttatttcataattttccagattttaaacaaaac
gacacacgtatagctgtatttggaaacacgacaataaaagctgtagaagctaaaggttta
agagtagatattgctgctccaacaccagaaacaccttctatgactatggctttaaaaaag
tatattgctgcggctaacaaaaagtaa

DBGET integrated database retrieval system