KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1376Help
Entry
Lacal_1376        CDS       T01533                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lacal_1376
Enzymes [BR:lan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Lacal_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566342..1566923
Genome map
AA seq 193 aa AA seqDB search
MITHIKGKMVEKNPTDVVIDCNGVGYLLNISLNTFSQIPDQESIHLFTHLQVKEDAHSLY
GFFTKGEREVFRLLISVSGIGTNTARTMLSSLTPKQIREGIATADVALIQSIKGIGAKTA
QRVILDLKDKILKIYDIDEVSVNRNNTNKDEALSALEVLGFAKKQAERVVDKIVVAQPEA
SVEAIIKLALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcacacatataaagggaaaaatggtggaaaaaaatccaacagatgttgtaatagac
tgcaacggtgttggatatttattaaatatttcattaaatactttttcccaaatcccagac
caagaaagcattcatttatttactcatttgcaggttaaagaagacgcccatagtctatat
ggcttctttacaaaaggcgaacgtgaggtttttagattactaatttcggttagtggtatt
ggtacaaatactgctagaaccatgctgtcttcattaacacctaagcaaattcgagaaggt
attgctactgcagatgttgctttaatacaatctattaaaggtattggagcaaaaactgcc
caacgtgttattttagatttaaaagacaaaattcttaaaatttacgatatagacgaagtt
tctgttaatagaaacaataccaacaaagatgaagcgttatctgctttagaagttcttggt
tttgccaagaaacaagcagaacgagtggtcgacaaaattgttgtagctcagccagaagct
tcggtagaagccataattaaactagctttaaaaaatttatag

DBGET integrated database retrieval system