KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1484Help
Entry
Lacal_1484        CDS       T01533                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lacal_1484
   00670 One carbon pool by folate
    Lacal_1484
Enzymes [BR:lan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Lacal_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1687959..1688861
Genome map
AA seq 300 aa AA seqDB search
MFKKKKQQPQIDPDQLALIENAQRRVKQKKHLYAHFVIFLIGAVFLIIANVGLGIGEEFQ
KFDLPWFVFAILIWLFFFLYHLFNVFITHKFMGKDWEKAQIEKLVAKQKAKIEKLEANLP
KSKTDSNLKSSSTTQIPHKNLTMIVAAGENNEIGKDNDLIWHLKDDLKRFKSLTSGHHII
MGRKTFESFPKPLPNRTHVVISRQKDYQVPVGVLVVHSLEDAIDAAKGDTQPFIIGGGEI
YRQAMPLAAKIEITRVHSTFNADTFFPEIDTTVWKETNSVVHPQDEDHKYAFSFITYERK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaaagaaacaacaacctcaaatagatccagaccagttagcattaattgaa
aatgcacaacgtcgtgtaaaacaaaaaaagcacttatatgctcactttgtaatattctta
attggagctgtttttttaattatagcaaatgtaggtttaggtataggagaagagtttcaa
aaatttgatcttccttggtttgtttttgctatattaatatggttatttttcttcttatac
catttatttaatgtatttataacgcataagtttatgggaaaagattgggaaaaagcccaa
atagaaaaactagtagcaaaacaaaaagctaaaattgaaaagttagaagcaaacttacca
aaatctaaaacagatagtaatttaaaatcaagttcaactacgcagataccgcataaaaat
ctaacaatgattgttgctgctggagaaaataatgaaataggaaaagataacgatttaatc
tggcacttaaaagatgatttaaaacgttttaaatctttaacctcaggacatcatattatt
atgggtcgtaaaacttttgaaagtttccctaaaccattaccaaatagaacacatgttgta
atttcaagacaaaaagattatcaagtgcctgttggtgttttagtagtgcattctttagaa
gatgctatagacgcggcaaaaggagatactcagccatttataattggaggcggcgaaatt
tatagacaagctatgcctttagcggctaaaattgaaataacaagagtacattctactttt
aatgcagatactttttttccggagatagacaccacagtttggaaagaaaccaatagtgtt
gttcatcctcaagacgaagaccataaatatgcattttcttttataacttatgaaagaaaa
taa

DBGET integrated database retrieval system