KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1733Help
Entry
Lacal_1733        CDS       T01533                                 

Definition
Tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lacal_1733
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lacal_1733
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lacal_1733
Enzymes [BR:lan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lacal_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963756..1964520)
Genome map
AA seq 254 aa AA seqDB search
MNRINKKLNEDKKLLSIYFTAGYPNLNNTVTIIENLEKNGVDMIEIGLPFSDPLADGPTI
QASSTQALKNGMTTNVLFKQLKDIRKTVSIPLIIMGYFNPMLQYGVEAFCKKCQDVGIDG
LIIPDLPVDVYNEKYKTVFEKYGLINVFLITPQTSEKRINFIDSISNGFIYMVSSASVTG
SNSGFGDEQTKYFKRIAKMNLKNPQIIGFGISDNETFSQATQHAKGAIIGSAFIKNLTKS
GLSKIDDFIKSIIN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaataaaaaattaaacgaagacaaaaagcttctttcaatatattttact
gcaggttatcccaacttaaataacaccgttacaataatagaaaacttagaaaaaaacggt
gtagacatgatagaaataggattaccatttagcgatcctttagccgatggaccaacaata
caagccagttcaacgcaagcacttaaaaatggtatgactactaatgtactttttaaacaa
ttaaaagatattagaaaaacagtatccataccattaataattatgggatatttcaaccca
atgctacaatatggtgtagaagcattttgtaaaaaatgtcaagatgttggtatagatggg
ttaattattccagacttgcctgtagatgtttataacgaaaaatataaaacagtatttgaa
aaatacggtctaataaatgtgtttttaataacaccacaaacaagcgaaaagcgaattaat
tttatagactctatttcaaatggatttatatatatggtaagtagtgcaagtgttactgga
agtaattctggttttggagacgagcaaaccaaatactttaaacgtattgcaaaaatgaac
ctaaaaaaccctcaaattattggttttggtatttcagataatgaaaccttttctcaagct
acacaacatgctaaaggtgcaataataggttcagcatttataaaaaatctcacaaaaagt
ggtttatcgaaaattgacgattttataaaatctattataaattaa

DBGET integrated database retrieval system