KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1733Help
Entry
Lacal_1733        CDS       T01533                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00260  Glycine, serine and threonine metabolism
lan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01130  Biosynthesis of antibiotics
lan01230  Biosynthesis of amino acids
Module
lan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lacal_1733
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lacal_1733
Enzymes [BR:lan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lacal_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth RRM_7
Motif
Other DBs
NCBI-ProteinID: AEH01581
UniProt: F6GDH7
Position
complement(1963756..1964520)
Genome map
AA seq 254 aa AA seqDB search
MNRINKKLNEDKKLLSIYFTAGYPNLNNTVTIIENLEKNGVDMIEIGLPFSDPLADGPTI
QASSTQALKNGMTTNVLFKQLKDIRKTVSIPLIIMGYFNPMLQYGVEAFCKKCQDVGIDG
LIIPDLPVDVYNEKYKTVFEKYGLINVFLITPQTSEKRINFIDSISNGFIYMVSSASVTG
SNSGFGDEQTKYFKRIAKMNLKNPQIIGFGISDNETFSQATQHAKGAIIGSAFIKNLTKS
GLSKIDDFIKSIIN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaataaaaaattaaacgaagacaaaaagcttctttcaatatattttact
gcaggttatcccaacttaaataacaccgttacaataatagaaaacttagaaaaaaacggt
gtagacatgatagaaataggattaccatttagcgatcctttagccgatggaccaacaata
caagccagttcaacgcaagcacttaaaaatggtatgactactaatgtactttttaaacaa
ttaaaagatattagaaaaacagtatccataccattaataattatgggatatttcaaccca
atgctacaatatggtgtagaagcattttgtaaaaaatgtcaagatgttggtatagatggg
ttaattattccagacttgcctgtagatgtttataacgaaaaatataaaacagtatttgaa
aaatacggtctaataaatgtgtttttaataacaccacaaacaagcgaaaagcgaattaat
tttatagactctatttcaaatggatttatatatatggtaagtagtgcaagtgttactgga
agtaattctggttttggagacgagcaaaccaaatactttaaacgtattgcaaaaatgaac
ctaaaaaaccctcaaattattggttttggtatttcagataatgaaaccttttctcaagct
acacaacatgctaaaggtgcaataataggttcagcatttataaaaaatctcacaaaaagt
ggtttatcgaaaattgacgattttataaaatctattataaattaa

DBGET integrated database retrieval system