KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1733Help
Entry
Lacal_1733        CDS       T01533                                 

Definition
Tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lan01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lan00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lan00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963756..1964520)
Genome map
AA seq 254 aa AA seqDB search
MNRINKKLNEDKKLLSIYFTAGYPNLNNTVTIIENLEKNGVDMIEIGLPFSDPLADGPTI
QASSTQALKNGMTTNVLFKQLKDIRKTVSIPLIIMGYFNPMLQYGVEAFCKKCQDVGIDG
LIIPDLPVDVYNEKYKTVFEKYGLINVFLITPQTSEKRINFIDSISNGFIYMVSSASVTG
SNSGFGDEQTKYFKRIAKMNLKNPQIIGFGISDNETFSQATQHAKGAIIGSAFIKNLTKS
GLSKIDDFIKSIIN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaataaaaaattaaacgaagacaaaaagcttctttcaatatattttact
gcaggttatcccaacttaaataacaccgttacaataatagaaaacttagaaaaaaacggt
gtagacatgatagaaataggattaccatttagcgatcctttagccgatggaccaacaata
caagccagttcaacgcaagcacttaaaaatggtatgactactaatgtactttttaaacaa
ttaaaagatattagaaaaacagtatccataccattaataattatgggatatttcaaccca
atgctacaatatggtgtagaagcattttgtaaaaaatgtcaagatgttggtatagatggg
ttaattattccagacttgcctgtagatgtttataacgaaaaatataaaacagtatttgaa
aaatacggtctaataaatgtgtttttaataacaccacaaacaagcgaaaagcgaattaat
tttatagactctatttcaaatggatttatatatatggtaagtagtgcaagtgttactgga
agtaattctggttttggagacgagcaaaccaaatactttaaacgtattgcaaaaatgaac
ctaaaaaaccctcaaattattggttttggtatttcagataatgaaaccttttctcaagct
acacaacatgctaaaggtgcaataataggttcagcatttataaaaaatctcacaaaaagt
ggtttatcgaaaattgacgattttataaaatctattataaattaa

DBGET integrated database retrieval system