KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1736Help
Entry
Lacal_1736        CDS       T01533                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lacal_1736
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lacal_1736
Enzymes [BR:lan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Lacal_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1966455..1967240)
Genome map
AA seq 261 aa AA seqDB search
MNILDKITRDKRIEVNLRKQLIPIKQLEQSILFNKTAVSLVNNLKNSTSGIIAEHKRRSP
SKQVINHDLNVFDVAKGYESAGVCGMSVLTDGKYFGGSLDDLLTARSNCNLPLLRKEFII
DSYQIIEAKAYGADVILLIAAILTKNEIKQFSELAKSLNLEVLLEIHNEEELHKSIMPSI
DMLGVNNRNLKTFNVSLETSKQLSQLIPNEFIKVSESGISSVEAIKSLQPFGYKGFLIGE
NFMKTNNAGESAKQFIKQINL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcttagataaaataacaagagacaaacgcatagaagttaatcttagaaagcaa
ttaatacctattaaacaattagagcaatctatattatttaacaaaacagcagtttcttta
gttaacaatttaaaaaacagcacttctggtattattgcagaacataaacgtcgttctccc
tcaaaacaagttataaatcacgatttaaatgttttcgatgtcgcaaaaggatacgaaagc
gctggtgtctgcggtatgtcggttttgacagatggcaaatattttggtggctctttagac
gatttacttacagcgagatccaattgtaatttaccattgttacgtaaagagtttattatt
gacagctatcaaattattgaagcaaaagcgtacggcgcagatgttatattgctaatagca
gcaatacttactaaaaatgaaataaagcaattttcggaactagcaaaaagcttaaactta
gaagtcttgttagaaatacataatgaggaagaattacataaatctattatgcctagtata
gatatgcttggtgtaaataatagaaatttaaaaacatttaatgttagcctagaaacaagc
aagcaattaagtcagcttataccaaatgaatttattaaagtatcagaaagtggcattagc
agtgttgaagccataaaaagcttacaaccatttggttacaaaggttttttaataggagaa
aactttatgaaaactaataacgcaggcgaaagtgcaaaacaatttataaaacaaataaac
ttataa

DBGET integrated database retrieval system