KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_1962Help
Entry
Lacal_1962        CDS       T01533                                 

Definition
magnesium chelatase subunit Chll
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lacal_1962
Enzymes [BR:lan01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Lacal_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2204976..2206442
Genome map
AA seq 488 aa AA seqDB search
MEIKNIKTLGELKNAGYKSKSIKDELRDNLIEKIKNKETTFKGVHGYENTVIPELERAIL
SRHNINLLGLRGQAKTRLARLMLNLLDEYIPVVEGSEINDDPLQPISRFAIELIKEKGEK
TPIIWLHRSERFAEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHYGMIPRANRCI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRLNLDMQFIFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPEDIETAKIITQQEAKLDKRQTNSVAIPELAKDLLEQIVFEARESEYI
DAKSGVSARLSITAFENLLSTAELRALKTGDTKTMVRLSDFLGIIPAITGKVELVYEGEQ
EGAAKVAFNLIGEAVKSLFPEFFPKIEKLQKQEEESPYDDVVSWFFNNRDGFELLDDLRD
KEYKHLLDAIAPLDDLLGEYQPNLDKTESYFVKEFVLWALVEYKQLSKYRYTEGIQFKDP
YGSFISGL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaaaatataaaaactttaggcgagttaaaaaacgctggatataaaagtaag
tctattaaagatgaacttagagataatttaatagagaaaattaagaataaagaaactaca
tttaaaggtgttcatggttacgaaaacaccgtaataccagagttagaacgtgcaatttta
tctagacataatattaatttattaggtttacgtggtcaagcaaaaacacgtttagcacgc
ttaatgctaaatttgttagacgaatatattcctgtagttgaaggcagcgaaattaatgac
gatcctttacagcctatttcacgatttgcaatagaattaattaaggaaaaaggagaaaaa
acaccaataatttggttacatagaagtgagcgttttgccgaaaaactagcaactccagat
gtaacagtggcagatttaataggtgatgtagacccaataaaagcagcgaatttaaagttg
agttatgcagacgatcgtgtaattcattacggaatgattccgcgtgctaaccgttgtatt
tttgttataaatgaattacccgatttacaagccagaattcaagtggctttatttaatatt
ctacaagaaggcgatatacaaattcgaggtttcaaacttaggttaaacttagatatgcag
tttatatttactgcaaatcctgaagattatactaaccgtggtagtattgtaacgccttta
aaagatagaattggttctcaaattttaacgcattatccagaagatattgaaactgcaaaa
ataattacacaacaagaagcaaaactagataaaagacaaacaaatagtgtcgctattcca
gagttggctaaagatttactggaacaaattgtttttgaagccagagaaagcgaatatata
gatgctaaaagtggtgtaagtgcaagattaagtattactgcattcgaaaatttattgagt
actgcagaacttcgcgctttaaaaacaggagacacaaaaacaatggtacgtttaagtgac
tttttaggtattattcctgcaattacaggaaaagtagaattagtttatgaaggagagcaa
gaaggtgctgcaaaagttgcatttaatttaataggtgaagccgtaaaaagtttatttcca
gagttttttcctaaaattgagaagctacaaaaacaagaagaagaaagtccttatgacgat
gtagtatcatggttttttaataatcgtgatggatttgaacttttagacgatttaagagat
aaagagtacaaacatttattagatgctattgctccattagatgatttacttggagaatac
caaccaaatttagataaaactgaaagctattttgtaaaagaatttgttttatgggcttta
gtagaatataaacaactaagtaaataccgttataccgaaggtatccagtttaaagatcca
tacggaagttttataagcggtttataa

DBGET integrated database retrieval system