KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2155Help
Entry
Lacal_2155        CDS       T01533                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lacal_2155
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lacal_2155
Enzymes [BR:lan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Lacal_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2416205..2417518
Genome map
AA seq 437 aa AA seqDB search
MGTFIIEGGHQLQGEIQPQGAKNEALQILCAVLLTPEKVTINNIPNIIDINKLIVLLSNL
GVKVEKLNEGSYSFQADDLNLEYLESAKFKEEGRGLRGSIMIVGPLLARFGKGYIPKPGG
DKIGRRRLDTHFEGFISLGAKFRYNREDYFYGVEAEQLVGTDMLLDEASVTGTANIVMAA
VLAKGTTTIYNAACEPYLQQLCKMLNRMGAKISGVGSNLLTIEGVDTLGGTEHTMLPDMI
EIGSWIGLAAMTKSELTIKNVSWDDLGQIPNVFRKLGITVERRGDDIFIPKHTDGYEIQN
YIDGSILTIADAPWPGFTPDLLSIVLVVATQAKGEVLVHQKMFESRLFFVDKVIDMGAKI
ILCDPHRATIIGHDFKSQLKATTMTSPDIRAGISLLIAALSAKGTSTIHNIEQIDRGYQH
IVKRLQRIGAKITRVDS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggtacatttattattgaaggtggtcaccaactacaaggcgaaatacaaccacaaggc
gcaaaaaatgaagcattacaaatactatgcgcagttttattaactccagaaaaagttact
ataaacaatattccaaatataattgacattaataagttaattgtattattaagtaactta
ggtgtaaaagtagaaaaacttaatgaaggttcttactcttttcaagcagatgatttaaat
ttagaatacttagaatctgcaaaatttaaagaagaaggtcgcggtttaagaggttctata
atgattgttggaccattattggcaagatttggtaaaggttatataccaaaaccaggaggt
gataaaataggaagaagacgtttagacacccattttgaaggctttattagccttggagct
aaatttagatataatcgtgaagattatttttatggagtagaagcagagcaattagttggt
acagatatgttgcttgacgaagcttctgtaacaggaacagcaaacatagtaatggctgct
gttttagcaaaaggaaccactactatatataatgcagcctgcgagccatacttacaacaa
ttatgtaagatgttaaaccgtatgggagcaaaaatctctggtgttggttctaatttatta
accattgaaggtgttgatactttaggcggaacagagcataccatgcttccagatatgata
gaaataggaagctggataggtttagctgctatgactaaaagtgaattaacaataaaaaat
gttagctgggatgatttaggacaaataccaaacgtatttagaaaattaggaattactgtt
gaaagacgtggtgacgatatttttatacctaaacatacagatggttacgaaatacaaaat
tacattgatggttctattttaaccatagccgatgcaccttggccaggatttacaccagat
ttattaagtatagtactggtagtagcaacacaagcaaaaggagaagttttagtacaccaa
aaaatgtttgaaagccgtttattttttgtagataaagtaattgatatgggtgcaaaaatt
atactttgtgatccacatagagcaacaataattggtcatgattttaaatctcaattaaaa
gcaacaaccatgacgtcgccagatattcgtgcaggtatttctcttttaattgctgcatta
tctgccaaaggaacatctacaatacataatattgaacaaatagatagaggttaccaacat
attgtaaaacgattacagcgtattggcgctaaaattacaagagttgatagttaa

DBGET integrated database retrieval system