KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2155Help
Entry
Lacal_2155        CDS       T01533                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lan00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lan00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2416205..2417518
Genome map
AA seq 437 aa AA seqDB search
MGTFIIEGGHQLQGEIQPQGAKNEALQILCAVLLTPEKVTINNIPNIIDINKLIVLLSNL
GVKVEKLNEGSYSFQADDLNLEYLESAKFKEEGRGLRGSIMIVGPLLARFGKGYIPKPGG
DKIGRRRLDTHFEGFISLGAKFRYNREDYFYGVEAEQLVGTDMLLDEASVTGTANIVMAA
VLAKGTTTIYNAACEPYLQQLCKMLNRMGAKISGVGSNLLTIEGVDTLGGTEHTMLPDMI
EIGSWIGLAAMTKSELTIKNVSWDDLGQIPNVFRKLGITVERRGDDIFIPKHTDGYEIQN
YIDGSILTIADAPWPGFTPDLLSIVLVVATQAKGEVLVHQKMFESRLFFVDKVIDMGAKI
ILCDPHRATIIGHDFKSQLKATTMTSPDIRAGISLLIAALSAKGTSTIHNIEQIDRGYQH
IVKRLQRIGAKITRVDS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggtacatttattattgaaggtggtcaccaactacaaggcgaaatacaaccacaaggc
gcaaaaaatgaagcattacaaatactatgcgcagttttattaactccagaaaaagttact
ataaacaatattccaaatataattgacattaataagttaattgtattattaagtaactta
ggtgtaaaagtagaaaaacttaatgaaggttcttactcttttcaagcagatgatttaaat
ttagaatacttagaatctgcaaaatttaaagaagaaggtcgcggtttaagaggttctata
atgattgttggaccattattggcaagatttggtaaaggttatataccaaaaccaggaggt
gataaaataggaagaagacgtttagacacccattttgaaggctttattagccttggagct
aaatttagatataatcgtgaagattatttttatggagtagaagcagagcaattagttggt
acagatatgttgcttgacgaagcttctgtaacaggaacagcaaacatagtaatggctgct
gttttagcaaaaggaaccactactatatataatgcagcctgcgagccatacttacaacaa
ttatgtaagatgttaaaccgtatgggagcaaaaatctctggtgttggttctaatttatta
accattgaaggtgttgatactttaggcggaacagagcataccatgcttccagatatgata
gaaataggaagctggataggtttagctgctatgactaaaagtgaattaacaataaaaaat
gttagctgggatgatttaggacaaataccaaacgtatttagaaaattaggaattactgtt
gaaagacgtggtgacgatatttttatacctaaacatacagatggttacgaaatacaaaat
tacattgatggttctattttaaccatagccgatgcaccttggccaggatttacaccagat
ttattaagtatagtactggtagtagcaacacaagcaaaaggagaagttttagtacaccaa
aaaatgtttgaaagccgtttattttttgtagataaagtaattgatatgggtgcaaaaatt
atactttgtgatccacatagagcaacaataattggtcatgattttaaatctcaattaaaa
gcaacaaccatgacgtcgccagatattcgtgcaggtatttctcttttaattgctgcatta
tctgccaaaggaacatctacaatacataatattgaacaaatagatagaggttaccaacat
attgtaaaacgattacagcgtattggcgctaaaattacaagagttgatagttaa

DBGET integrated database retrieval system