KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2430Help
Entry
Lacal_2430        CDS       T01533                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lacal_2430
  Amino acid metabolism
   00340 Histidine metabolism
    Lacal_2430
Enzymes [BR:lan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Lacal_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2700479..2701762
Genome map
AA seq 427 aa AA seqDB search
MRTISNPKQSTWLDILKRPTQTVNDIETTVTQIFEDVQRNGDQAVAKYTQLFDGVELTSN
IVSTEEVELASSKISENLKQAIQQAKTNIETFHKAQKTEKVSVETTQGVNCWQEKRAIQK
VGIYIPAGTAPLFSTVLMLAVPAQIAGCKEIILCSPPNKEGKIANEILYAAQLCGVTKII
KVGGIQAIAGLTFGTESMPQVYKIFGPGNQFVTVAKQLATKYGVAIDMPAGPSELLVVAD
DTANASYVASDLLSQAEHGADSQVILVSTSQNFINAVAEEIKVQIKALPRQDIAKQAIEN
SKSILVETDAIALDLINQYGPEHFIVCTKNDDFYVNGIENAGSVFIGNYTPESAGDYASG
TNHTLPTNGFSKAYSGVNLDSFTKAITFQNITKQGLLNIGNTIELMAEAEGLQAHKNAVT
LRLNDLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagaactattagcaatcctaaacaatccacttggttagatattttaaaacgaccaacg
caaaccgttaacgatattgaaactacggtcactcaaatttttgaagacgtacaacgtaat
ggagaccaagcagtagcaaaatatacacaattatttgatggtgtagaattaacatcaaat
attgtaagtactgaagaagttgaattagcaagttctaaaatctcagaaaatttaaagcaa
gccatacaacaagcaaaaacaaatattgaaacttttcacaaagcacaaaaaacagaaaaa
gttagtgttgaaactactcaaggcgtaaactgttggcaagaaaaaagagccattcaaaaa
gttggtatttacattcctgctggtacagcaccattgttttcaaccgttttaatgttagct
gttcctgcgcaaatagcaggatgtaaggagataatattatgttcgcctccaaataaggaa
ggaaaaatagctaatgaaattttatacgcagcgcaattatgtggtgtaaccaaaattatt
aaagttggtggcattcaagccattgccggtttaacctttggaacagaaagtatgccgcag
gtttataaaatttttggaccaggaaaccaatttgtaaccgtagcaaaacaattagcaact
aaatatggtgtcgcaatcgatatgccagcaggaccaagtgagttattagttgtagcagat
gatactgcaaatgcaagttatgtggcttcagatttgttatctcaagcagaacatggcgca
gatagtcaagtcattttggtgtctacatctcaaaatttcattaacgctgtagcggaagaa
ataaaggttcaaataaaagcacttccaagacaagatattgctaaacaagcgatagagaat
tcaaaatctattttagttgaaactgatgctatagcattagatttaatcaatcaatatgga
ccagaacactttatagtgtgtacaaaaaatgatgatttttacgttaacggaattgaaaac
gcaggatctgtatttattggtaattatacaccagaaagtgctggagattatgcatctggt
accaatcacaccttaccaaccaatgggtttagtaaagcgtattctggagtgaatttagat
agttttactaaagcaattacatttcaaaatataacaaaacaaggtttgcttaatattggg
aatactattgagttaatggctgaagctgaaggtttacaagcgcacaaaaatgcagtaact
cttcgtttaaacgatttaaagtaa

DBGET integrated database retrieval system