KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2588Help
Entry
Lacal_2588        CDS       T01533                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lacal_2588
   01230 Biosynthesis of amino acids
    Lacal_2588
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lacal_2588
   00030 Pentose phosphate pathway
    Lacal_2588
   00051 Fructose and mannose metabolism
    Lacal_2588
   00052 Galactose metabolism
    Lacal_2588
  Energy metabolism
   00680 Methane metabolism
    Lacal_2588
Enzymes [BR:lan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lacal_2588
Protein phosphatases and associated proteins [BR:lan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lacal_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2874473..2875459)
Genome map
AA seq 328 aa AA seqDB search
MSQTIKKIGVMTSGGDSPGMNAAIRSVARTCAFHSIECVGIYRGYEGMIEGDFEELTARS
VKGIINKGGTVLKSARSTEFRTPEGRKKAYKALKENGVDALVVIGGDGTFTGALIFNQEY
NFPVIGIPGTIDNDIYGTSHTLGYDTALNTVVESIDKIRDTASSHNRLFFVEVMGRDVGH
IALNVGIGAGAEEILIPEEDLGLDRLLESLRRSKKSGKSSSIVVVAEGDKIGKNVFELRD
YVEENMTEYEVRVSVLGHMQRGGAPSCFDRVLASRMGVKAVESLMEGESNYMVGLSSDKI
VLTPLEKAVKGKSKINKELIRVSDIMTT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaacaataaaaaaaataggtgtaatgacctctggtggtgactctccaggaatg
aatgccgcaattagatctgtagccagaacttgtgcatttcatagtatagaatgtgtaggt
atttatagaggatacgaaggcatgatagaaggtgattttgaagagcttaccgcacgaagt
gtgaaaggtattattaataaaggaggaaccgttttaaaatctgcaagatctacagaattt
agaactccagaaggtagaaaaaaagcgtataaagcattaaaagaaaatggagtagatgct
ctagtagtaattggtggagatggtacttttacaggagctttaatatttaatcaagagtac
aattttccagtaataggaattccaggcactatagataatgatatttatggtacttcacat
acattaggttacgatacagcactaaatacagtagtagaatctatagataaaattagagac
acagcaagttcacataaccgcttgttttttgtagaagttatgggacgtgatgttggacat
attgcattaaatgttggaataggagctggagctgaagaaattttaattccagaagaagac
ctaggtttagatagattattagagtcacttcgtagaagtaaaaaatctggtaaatcttca
agtattgtagttgttgccgaaggtgataaaataggtaaaaatgtattcgaacttagagat
tatgttgaagaaaacatgacagaatatgaagttagagtatctgtacttggccacatgcaa
cgtggtggcgcaccatcatgttttgatcgtgtgttagcaagtagaatgggagttaaagca
gtagaaagtttaatggaaggcgaatctaattatatggttggtttatctagtgataaaatt
gtgttaacaccattagaaaaagcagtaaaaggaaaatctaaaataaataaagaattgatt
agagtgtcagatattatgactacataa

DBGET integrated database retrieval system