KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2615Help
Entry
Lacal_2615        CDS       T01533                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lacal_2615
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lacal_2615
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lacal_2615
Enzymes [BR:lan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lacal_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2913097..2914392
Genome map
AA seq 431 aa AA seqDB search
MKYYSLNHKAENTSFKNAVVKGLAPDKGLYFPENITPLPKSFFDNIQNLSNTEIAFQAIK
QFVTPDIPEQVLKTIIEETLSFNFPIVNLSEHISTLELFHGPTMAFKDVGARFMARCLGY
FNKENSNEVTVLVATSGDTGGAVANGFLGVKGVNVVILYPSGKVSDIQEKQLTTLGNNIT
ALEVDGVFDDCQDMVKRAFLDEDLTSKMQLTSANSINVARWLPQLFYFMFAYKQLHKKHE
NIVFSVPSGNFGNVCAGMMAQQLGLPIKHFIASNNENNVVTNYLHTKEYKPKPSVQTISN
AMDVGNPSNFIRIKEIYKNNFDSLKTNLSSYSFNDIETKKALKEIFDNYNYVADPHGAVG
YLGCKAYLKDNKNSHCVFLETAHPTKFLDVVEEVIKEKQLLPKQIQAVIDKEKVSTQIST
YNELKQFLLNK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattactcactaaaccataaagctgaaaatacaagttttaaaaatgctgttgtt
aaaggtttagcaccagataaaggattgtactttcctgaaaacataacacctttaccaaaa
tcttttttcgataacattcaaaatctaagtaataccgagattgcttttcaagctataaaa
caatttgtaacaccagatattcctgagcaggttttaaaaacaattatagaagaaacgcta
tcttttaattttcctattgtaaatttaagtgagcatatttctacattagagttatttcat
ggaccaacaatggcttttaaagatgttggagctagatttatggcaagatgcttaggctat
tttaataaagaaaacagtaacgaagtcacagtattagtagctacttctggagatactgga
ggcgcagtggcaaacgggtttttgggtgtaaagggagtaaatgttgttatattatatcct
agcggaaaagtaagtgatatacaagaaaaacaattaacaacgttaggaaacaatattaca
gctttagaagttgatggtgtttttgatgattgccaagatatggttaagcgtgcattttta
gacgaagatttaacaagtaaaatgcaattaacctctgcaaattcaattaatgttgcgcgt
tggttaccacaacttttctattttatgtttgcatacaaacaattacataaaaaacatgaa
aacattgtattctcggtacctagcggtaattttggaaatgtttgcgctggtatgatggca
cagcaattagggctaccaattaaacattttatagcttctaataatgaaaacaatgttgtt
actaattacttacatacaaaggagtacaaaccaaaaccatctgtacaaactattagtaat
gcaatggatgttggtaatccaagtaattttataagaattaaagaaatttataaaaataat
ttcgatagtttaaaaacaaacttatcctcatatagttttaatgatattgaaactaaaaag
gctttaaaagaaatttttgataactataattatgtagcagatccacatggcgctgttgga
tatttgggctgtaaagcatatttaaaagataataaaaatagccattgtgtgtttttagaa
acagcacacccaactaagtttttagatgttgtagaagaagttattaaagaaaaacaacta
ttaccaaagcaaattcaagcggttatagataaagaaaaagtttcaacccaaataagtact
tataatgagttgaaacagtttcttttaaataagtaa

DBGET integrated database retrieval system