KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2770Help
Entry
Lacal_2770        CDS       T01533                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lan01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lan01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3076671..3077405)
Genome map
AA seq 244 aa AA seqDB search
MTILIFIIILWYTGLFFQTFFLHRYAAHQTFTMSKITERVCFVLTWVFQGSNYLSAYGYG
VMHRMHHAYADTENDPHSPKYDPNLFSMMWRTKNIYQDINKKRIAVANKFTKNVPQWKRF
DQFASSRASRLTWAALYITFFALFATAWWQWLLLPVAFFMAPIHGVIINWFAHIYGYTNF
KVKDTSKNLLPFDFLMMGESYHNNHHTHSGRANFGVKWHEIDFTYCIMVVLDKLKIIKLK
KAAI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgactattttaatatttataattattctgtggtatacaggtttattttttcaaacattt
tttctacaccgttacgcagcacatcaaacctttacaatgtctaaaattacagagcgtgtt
tgctttgtattaacatgggttttccaaggaagtaactatttaagtgcttatggttatggt
gtaatgcatagaatgcatcacgcttatgcagatacagaaaacgatccacattcaccaaaa
tacgatcctaatttgttttctatgatgtggcgaacaaaaaatatttatcaagacataaat
aaaaaacgtattgcggttgcaaataaatttaccaaaaacgtaccacaatggaaacgtttt
gaccaatttgcaagctcacgagcatcacgcttaacatgggctgcgttatatattactttt
tttgcactatttgctacggcatggtggcaatggttattattgccagtagcattttttatg
gcaccaattcatggtgttataattaattggtttgcacatatttatggttatacaaatttt
aaagtaaaagatacttctaaaaacctattaccgttcgattttttaatgatgggagaaagt
taccataataatcaccacacacatagtggtcgtgctaattttggagtaaaatggcacgaa
atagattttacatactgtataatggtagttttagataagcttaaaattataaagcttaaa
aaagctgctatttaa

DBGET integrated database retrieval system