KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_2944Help
Entry
Lacal_2944        CDS       T01533                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Brite
Enzymes [BR:lan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Lacal_2944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3259345..3259986)
Genome map
AA seq 213 aa AA seqDB search
MRDTFKHQGLRQQLVNVLKNKGITDASVLAAIGKIPRHLFMDSSFLEHAYQDKAFPIAAD
QTISQPYTVAFQTELMQVNRGDKILEIGTGSGYQTAVLCEIGAKVYSIERQQELFKKTSK
FLPKLGYRAKKLIFGDGYKGLVEQAPFKSIIVTAGAPFVPKPLLAQLEIGGRLVIPVGDK
VQTMTLFVRKGPMDFDKTEFGEFRFVPLLEDKN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgagagatacttttaaacatcaaggcttaagacaacaacttgttaatgtgttaaaaaac
aaaggtattacagatgcttctgtattagctgctattggtaaaataccacgccatttattt
atggattctagttttttagaacatgcttatcaagataaagcgtttcctattgctgcagac
caaactatttctcaaccttacacagtagcttttcaaaccgaattaatgcaagtaaatcgc
ggtgataaaattttagaaattggtactggtagtggttatcaaactgcagtattatgcgaa
ataggtgcaaaagtttatagtattgaaaggcaacaagagctttttaaaaaaaccagcaaa
tttttaccaaaattgggatatagagctaaaaaactaatttttggtgacggttataaaggt
ttggtagagcaagcaccttttaaaagtattattgtaacagctggtgcaccttttgtgcca
aaaccattattggcacaattagaaattggtgggcgacttgtaatacctgttggtgataaa
gtacagacgatgacactttttgttagaaaaggtccaatggattttgataaaaccgagttt
ggtgagtttaggtttgtaccacttttagaagataaaaactaa

DBGET integrated database retrieval system