KEGG   Lupinus angustifolius (narrow-leaved blue lupine): 109333487Help
Entry
109333487         CDS       T04664                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
lang  Lupinus angustifolius (narrow-leaved blue lupine)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lang00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109333487
   00500 Starch and sucrose metabolism
    109333487
Enzymes [BR:lang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109333487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
LG02
AA seq 581 aa AA seqDB search
MILSSIWVLTFFSFIYVNGVLPIEATHHSFRELQNLSSDYYKQPYRTAYHFQPPKNWIND
PNGPLRYKGLYHLFYQYNPKGAVWGNIVWAHSVSKDLVNWAPLDPAIFPSQPSDINGCWS
GSTTLIHGGKPVILYTGINPLNQQVQNLAYPKNLSDPFLREWVKSPKNPLMAPTSANKIN
SSSFRDPTTSWLGKDGYWRVLIGSKRNTLGLAILYKSKDFVNWAKAKYPLHSVQGTGMWE
CPDFFPILNDSPIGIDTSFNGDNIRHVLKVSLDDKKHDYYMIGSYDIVKDKFIPDKAFKD
SESFLRYDYGKYYASKTFFDDGKNRRILLGWVNESSSVAHDIKKGWSGIHAIPRAIWLDK
SGKQLVQWPVVEIEKLRANPVNWPTKLLKGGHLLQINGVTAAQADVEISFEVNNLGEAEV
LDNWTDPQSLCSQKGPTYKSGLGPFGLLVFASKGLQEYTSVYFKIFRYQHKNLVLLCSDQ
SRSSLDNNNDKTNYGTFVDVDPLHEKLSLRSLIDHSVVESFGGEGKACITARVYPTLAIN
DEAQLYVFNNGTADVKLTRLSAWSLKKAQINGKIKIDKTGL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgattttatcttcaatatgggtgttgacctttttttctttcatttatgttaatggtgtt
cttcctattgaagctacccaccattcttttagagaacttcagaatctatcatctgattat
tacaaacaaccttacagaactgcttatcactttcaacctccaaagaattggataaatgat
cctaatggaccattgagatacaaaggattgtatcacctgttctaccaatacaaccctaaa
ggtgcagtctggggaaatattgtgtgggcccactcagtatcaaaggatcttgtaaattgg
gccccacttgatcctgccatctttccatctcagccgtcagatatcaatggctgttggtca
ggatcaactacattaattcatgggggcaaaccagtaattttgtacacaggaatcaaccct
ttgaatcaacaagttcaaaacttagcctaccctaaaaacttgtctgacccatttctaagg
gaatgggttaagtcacccaaaaacccactaatggcaccaactagtgctaataagataaat
tcaagttcttttagggaccctaccacttcttggctagggaaagatgggtattggagggta
ttaattgggagcaaaaggaacactttagggttagcaattttgtataaaagcaaggatttt
gttaattgggctaaagctaaatacccattacattcagtccaaggtactggaatgtgggag
tgccctgattttttcccaattctaaatgatagtccaattggtattgacacatcttttaat
ggtgataatattaggcatgtgcttaaggttagtttggatgataaaaaacatgattactat
atgattgggagttatgatatagttaaggataaatttatacctgataaagcattcaaggat
agtgaatcatttttaagatatgattatggaaaatattatgcatcaaaaactttctttgat
gatggaaagaatagaaggatattgcttggttgggtcaatgagtcttcaagtgttgctcat
gatattaagaaaggatggtctggaatccatgcaattccaagggctatatggctagataag
tcaggtaaacaattggtgcaatggccagttgtggaaattgaaaagctacgtgcaaatcca
gtcaattggcctactaaactgctcaagggtggtcacctgcttcaaattaatggtgtcaca
gcagcacaagctgatgttgaaatttcatttgaggtgaataatttaggagaggctgaagta
ttggacaattggacagaccctcaaagtctctgtagccaaaagggtccaacctataaaagt
ggattaggaccttttggtctgttagtttttgcttcaaagggattgcaagagtatacatca
gtgtacttcaaaatattcagataccaacacaaaaatttggtgctattgtgtagtgaccaa
agcaggtcttcattggacaacaataatgataaaaccaattatgggacttttgtggatgtg
gaccctcttcatgagaagctgtcattgagaagtttgattgatcactcagtcgtagagagt
tttggaggagaaggaaaagcttgtatcacagctagagtttatccgacattggcgatcaat
gatgaggcacaactatatgtttttaataatggaactgcagatgttaagttaacaagattg
agcgcttggagcttgaagaaagcacaaataaatggaaaaattaagatagataaaactgga
ctttga

DBGET integrated database retrieval system