KEGG   Candidatus Liberibacter americanus: lam_825Help
Entry
lam_825           CDS       T02902                                 

Gene name
glsA
Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lar  Candidatus Liberibacter americanus
Pathway
lar00220  Arginine biosynthesis
lar00250  Alanine, aspartate and glutamate metabolism
lar00471  D-Glutamine and D-glutamate metabolism
lar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lar00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lam_825 (glsA)
   00220 Arginine biosynthesis
    lam_825 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    lam_825 (glsA)
Enzymes [BR:lar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     lam_825 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AHA28164
UniProt: U6B513
Position
complement(939147..940079)
Genome map
AA seq 310 aa AA seqDB search
MDLKKILYDIYEDIKPCIGQGLVADYIPELAKVDPDHFGMSIALPDGNVYSVGDFDVFFS
VQSISKVFLLTMVLQNFGDDVWKRIGREPTGWSFDSIIQLEYEHGVPRNPFVNAGSIVMA
DMMLEGISTDCAIENFLIFMRKISDDQSIYIDSIVADSEISTGYRNYALANSIHSYRNLN
HNIEDVLKVYFNHCAIVMNCAQLARSGLYLSCRGFDPLINQHIISPQHCKFINSLMLTCG
HYDNSGDFACRVGLPGKSGVGGGILAVVPSKASIAVWSPGLNKAGNSLLGANALELLSSK
TGWSIFDFQQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttggatttaaagaaaattttatatgatatttatgaagatataaagccttgcattggtcaa
ggccttgtggctgattatatccctgaattagctaaagtggatcctgatcactttggaatg
tctattgctctgccagatggaaatgtgtattctgtaggagattttgatgtatttttttca
gtacaaagtatttcaaaagtctttcttctcacgatggttttgcaaaattttggtgatgat
gtttggaaacgtataggtcgtgaaccaacaggatggtcttttgattcaataattcaactt
gaatatgagcatggtgtcccgcgtaatccgtttgttaatgctggctctatagttatggct
gatatgatgcttgaaggaatttctactgattgtgcaatagaaaacttcctaatttttatg
agaaagatttctgatgatcaatctatttatatagattctattgttgcagattcagaaatt
tctactggctatcgtaattatgctcttgcaaactctattcattcatatagaaatttaaat
cataatattgaggatgttttaaaagtttattttaatcattgcgctattgttatgaattgt
gcgcaacttgcaagatcgggattatatctttcatgtcgtggtttcgatccgttaataaat
caacatataatatctccgcaacattgtaaatttataaattccttaatgcttacgtgtggt
cattatgataattctggtgattttgcatgtcgtgttggtttgcctggcaaaagtggtgtt
ggtggtggaattttagctgtcgttccgtctaaagcatctattgcagtatggtctcctggt
ttgaataaagctggtaattctttgttaggggcaaatgctcttgagcttttatcgtctaaa
acaggttggtctatttttgattttcaacaataa

DBGET integrated database retrieval system