KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00410Help
Entry
CLIBASIA_00410    CDS       T00948                                 

Definition
triosephosphate isomerase protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLIBASIA_00410
   01230 Biosynthesis of amino acids
    CLIBASIA_00410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLIBASIA_00410
   00051 Fructose and mannose metabolism
    CLIBASIA_00410
   00562 Inositol phosphate metabolism
    CLIBASIA_00410
Enzymes [BR:las01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLIBASIA_00410
Exosome [BR:las04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLIBASIA_00410
  Exosomal proteins of bladder cancer cells
   CLIBASIA_00410
  Exosomal proteins of melanoma cells
   CLIBASIA_00410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(87823..88617)
Genome map
AA seq 264 aa AA seqDB search
MKVGIRPLVVGNWKMHGLRLSLERIQKIVEGIRRNSCCIDVAICPPATLIYESSRLCKTS
SVIIGAQDCHIAEYGPYTGDISANMLADCGANFVILGHSERRIGHREDSYVVQSKVKSAC
NAGLYPIVCIGETDEEYRSGRTFEVLQKQLDCSLPSEFKSSVPVIAYEPIWAIGTGRVPA
VVDLEKIHSFVRRILLDRFPEEGQKMRILYGGSVDVANAEDFSLIENIDGLLVGGASLQH
ELFLKIVEIVERVYVDSCLEDTSL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaggcattcgtccacttgtagttggaaactggaaaatgcatggattgcgttta
tctcttgaaagaattcagaaaattgttgaaggtataagaaggaatagttgttgtattgat
gttgctatatgtccaccggcaaccttaatatacgaatcttctcgtctttgtaaaacatct
tcggtaattattggggcgcaggattgtcatatagctgaatatggaccttatacaggtgat
atttcggcaaatatgttggcagattgtggggctaatttcgtaattttaggtcattccgaa
cgacgtattggtcatcgagaggacagctacgttgtgcaatctaaagtaaaatctgcttgt
aatgcagggttatatcccatagtatgcattggggagaccgatgaggaatatcgttctggt
agaacctttgaagtattgcaaaaacaattagattgtagtttgccgagtgagtttaaatct
tcggttcccgttattgcctatgagcctatatgggcgattggtacgggtcgtgtccctgct
gttgttgatcttgaaaagattcactcttttgtgcgtcgtattttattggatcgttttcct
gaagaggggcagaagatgcgtattctatatggtggatcagtggatgtcgcgaatgcagaa
gatttttcgttgattgaaaatatagatgggttattagtcggtggagcgagccttcaacat
gaattatttttaaaaattgttgagattgttgagcgcgtgtacgttgattcttgtcttgaa
gatacgtcattatag

DBGET integrated database retrieval system