KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00825Help
Entry
CLIBASIA_00825    CDS       T00948                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLIBASIA_00825 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLIBASIA_00825 (glk)
   00052 Galactose metabolism
    CLIBASIA_00825 (glk)
   00500 Starch and sucrose metabolism
    CLIBASIA_00825 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CLIBASIA_00825 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLIBASIA_00825 (glk)
   00524 Butirosin and neomycin biosynthesis
    CLIBASIA_00825 (glk)
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLIBASIA_00825 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(166467..167513)
Genome map
AA seq 348 aa AA seqDB search
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIY
RKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAI
CSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGP
STQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSE
DPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSP
HKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatatcgaaaaaagattttccgattgcttttcctgttctcttggcagatata
ggaggaacgaatgttcgttttgcgatattgcgcagtatggaatctgagcctgaattttgt
tgtacagtacagacctctgattatgagaatttggagcatgcaatacaggaggtaatttac
cgtaaaatttccatacgattacgttctgcttttctagctattgcgactccgattggtgat
caaaaaagttttacgctgacaaattaccattgggttattgatccagaagaattaatctca
cgtatgcagtttgaagatgtgttgttgattaatgattttgaagcacaggcactcgctatt
tgttctttgtcttgttccaattatgtttctattggtcagtttgtagaagataatcgctct
cttttttcgtctcgagtaatcgttggacctggaacaggattggggatttcgagtgtaata
agggcaaaagattcgtggattccaatttcttgtgaaggaggtcacatggatataggtccc
agtacacaacgtgattatgaaatttttccccatttgacagagcgtgctgaaggacgatta
tctgctgaaaatttgctctctggtaaaggtcttgtcaatatttataaagcactctgtatt
gccgatggttttgaaagtaataaagtattatcttcaaaggatattgtctctaagagtgaa
gatcctatcgctttgaaggcaattaatcttttttgtgagtatcttggaagggttgcaggt
gatcttgctttgatttttatggcgagaggtggggtgtatatttccggtggtatcccttat
aaaatcatagatttattgcgtaattccagttttcgagaatctttcgaaaacaaatcgcca
cataaggaacttatgcgtcaaatacctacatatgttataaccaatccttatattgcaatt
gcaggtatggtttcttacatcaagatgacagattgcttcaatcttttcattagtgaagga
attaaacgtcgttggttcaaagattga

DBGET integrated database retrieval system