KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_00825Help
Entry
CLIBASIA_00825    CDS       T00948                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00010  Glycolysis / Gluconeogenesis
las00052  Galactose metabolism
las00500  Starch and sucrose metabolism
las00520  Amino sugar and nucleotide sugar metabolism
las00521  Streptomycin biosynthesis
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
Module
las_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLIBASIA_00825 (glk)
   00052 Galactose metabolism
    CLIBASIA_00825 (glk)
   00500 Starch and sucrose metabolism
    CLIBASIA_00825 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CLIBASIA_00825 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLIBASIA_00825 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLIBASIA_00825 (glk)
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLIBASIA_00825 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACT56753
UniProt: C6XHL0
Position
complement(166467..167513)
Genome map
AA seq 348 aa AA seqDB search
MNNISKKDFPIAFPVLLADIGGTNVRFAILRSMESEPEFCCTVQTSDYENLEHAIQEVIY
RKISIRLRSAFLAIATPIGDQKSFTLTNYHWVIDPEELISRMQFEDVLLINDFEAQALAI
CSLSCSNYVSIGQFVEDNRSLFSSRVIVGPGTGLGISSVIRAKDSWIPISCEGGHMDIGP
STQRDYEIFPHLTERAEGRLSAENLLSGKGLVNIYKALCIADGFESNKVLSSKDIVSKSE
DPIALKAINLFCEYLGRVAGDLALIFMARGGVYISGGIPYKIIDLLRNSSFRESFENKSP
HKELMRQIPTYVITNPYIAIAGMVSYIKMTDCFNLFISEGIKRRWFKD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatatcgaaaaaagattttccgattgcttttcctgttctcttggcagatata
ggaggaacgaatgttcgttttgcgatattgcgcagtatggaatctgagcctgaattttgt
tgtacagtacagacctctgattatgagaatttggagcatgcaatacaggaggtaatttac
cgtaaaatttccatacgattacgttctgcttttctagctattgcgactccgattggtgat
caaaaaagttttacgctgacaaattaccattgggttattgatccagaagaattaatctca
cgtatgcagtttgaagatgtgttgttgattaatgattttgaagcacaggcactcgctatt
tgttctttgtcttgttccaattatgtttctattggtcagtttgtagaagataatcgctct
cttttttcgtctcgagtaatcgttggacctggaacaggattggggatttcgagtgtaata
agggcaaaagattcgtggattccaatttcttgtgaaggaggtcacatggatataggtccc
agtacacaacgtgattatgaaatttttccccatttgacagagcgtgctgaaggacgatta
tctgctgaaaatttgctctctggtaaaggtcttgtcaatatttataaagcactctgtatt
gccgatggttttgaaagtaataaagtattatcttcaaaggatattgtctctaagagtgaa
gatcctatcgctttgaaggcaattaatcttttttgtgagtatcttggaagggttgcaggt
gatcttgctttgatttttatggcgagaggtggggtgtatatttccggtggtatcccttat
aaaatcatagatttattgcgtaattccagttttcgagaatctttcgaaaacaaatcgcca
cataaggaacttatgcgtcaaatacctacatatgttataaccaatccttatattgcaatt
gcaggtatggtttcttacatcaagatgacagattgcttcaatcttttcattagtgaagga
attaaacgtcgttggttcaaagattga

DBGET integrated database retrieval system