KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01185Help
Entry
CLIBASIA_01185    CDS       T00948                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLIBASIA_01185
Enzymes [BR:las01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CLIBASIA_01185
Exosome [BR:las04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLIBASIA_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247816..248829
Genome map
AA seq 337 aa AA seqDB search
MCNTNAISHKICCHRRMRRNRKSNWIREMVREHRLSVSDLILPIFLTSGEKTVESINSMP
DVMRMSIDVAVEKIKQVADLGIPAIAIFPNIPMDLRNNTGSHIIDPDNLINEGICAIKKN
IPNIGIITDVALDPFTIHGHDGILCDGEIVNDETIELISHAAVIQADAGADIIAPSEMMD
GRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRDAISTRDLLKGDKKTYYLDPANVQ
EAIREASIDIQESADMLLVKPGLPYLDVCFRIKEKFGLPTFAYQVSGEYAMIKAASLQGW
INKNDAMMESLLAFKRAGCDGIFTYFAMEAARILTHS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtaataccaatgcaattagtcataagatatgttgtcatcgacgtatgagaagaaat
cgtaagtccaattggatacgggaaatggttcgggagcatcggttatctgtcagcgatctc
atcttacccatattcctcacttctggggaaaaaacagtagagtcaataaattccatgcct
gatgttatgcgtatgagtattgatgttgcagtagagaaaatcaagcaagttgctgattta
ggaataccagctatcgctatattccctaatatcccaatggatttacgcaataatacagga
tcacatatcatagatccagataacctgattaatgaaggcatttgcgctatcaagaaaaat
attcccaatataggcattatcacggatgttgccttggatccttttaccatacatggacat
gatggcatattatgcgatggtgaaatcgttaatgacgaaacgatagaactcatctcacat
gcagcagtaatacaagcagatgcaggagcggatatcatcgctccatcggaaatgatggat
gggcgagtgcaagagattagaaaaaaacttgatagtcatggtcacatcaatgtgggtatt
atgccctatgtcgccaaattcaattcttcattttatggaccatatcgtgatgctatttcc
actcgagaccttttgaaaggggataagaaaacttattatttggatcctgctaacgtacaa
gaagcaatccgcgaagcatctattgatattcaagaaagcgctgatatgcttttggtaaaa
cctggattaccttatttggatgtctgtttccgaattaaagaaaaattcggattacccact
tttgcctatcaagtatctggcgaatatgccatgatcaaagcggcctctcttcaaggatgg
atcaacaaaaacgatgcgatgatggagagtttactagcctttaaacgcgcaggatgcgat
ggtatttttacctattttgcaatggaagctgcccgtattcttactcattcttag

DBGET integrated database retrieval system